SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|226498382|ref|NP_612385.2| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|226498382|ref|NP_612385.2|
Domain Number 1 Region: 91-140,168-274
Classification Level Classification E-value
Superfamily TPR-like 0.00000000000000402
Family Tetratricopeptide repeat (TPR) 0.014
Further Details:      
 
Weak hits

Sequence:  gi|226498382|ref|NP_612385.2|
Domain Number - Region: 8-94
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0547
Family Spectrin repeat 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|226498382|ref|NP_612385.2|
Sequence length 440
Comment tetratricopeptide repeat protein 5 [Homo sapiens]
Sequence
MMADEEEEVKPILQKLQELVDQLYSFRDCYFETHSVEDAGRKQQDVQKEMEKTLQQMEEV
VGSVQGKAQVLMLTGKALNVTPDYSPKAEELLSKAVKLEPELVEAWNQLGEVYWKKGDVA
AAHTCFSGALTHCRNKVSLQNLSMVLRQLRTDTEDEHSHHVMDSVRQAKLAVQMDVHDGR
SWYILGNSYLSLYFSTGQNPKISQQALSAYAQAEKVDRKASSNPDLHLNRATLHKYEESY
GEALEGFSRAAALDPAWPEPRQREQQLLEFLDRLTSLLESKGKVKTKKLQSMLGSLRPAH
LGPCSDGHYQSASGQKVTLELKPLSTLQPGVNSGAVILGKVVFSLTTEEKVPFTFGLVDS
DGPCYAVMVYNIVQSWGVLIGDSVAIPEPNLRLHRIQHKGKDYSFSSVRVETPLLLVVNG
KPQGSSSQAVATVASRPQCE
Download sequence
Identical sequences Q8N0Z6
ENSP00000258821 gi|226498382|ref|NP_612385.2| NP_612385.2.87134 NP_612385.2.92137 XP_003811766.1.60992 ENSP00000258821 ENSP00000258821 9606.ENSP00000258821

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]