SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|227430327|ref|NP_001222.3| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|227430327|ref|NP_001222.3|
Domain Number 1 Region: 263-381
Classification Level Classification E-value
Superfamily Thioredoxin-like 2.2e-57
Family Calsequestrin 0.000000581
Further Details:      
 
Domain Number 2 Region: 161-260
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.99e-27
Family Calsequestrin 0.00000602
Further Details:      
 
Domain Number 3 Region: 39-160
Classification Level Classification E-value
Superfamily Thioredoxin-like 2.9e-23
Family Calsequestrin 0.00000111
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|227430327|ref|NP_001222.3|
Sequence length 396
Comment calsequestrin-1 [Homo sapiens]
Sequence
MSATDRMGPRAVPGLRLALLLLLVLGTPKSGVQGQEGLDFPEYDGVDRVINVNAKNYKNV
FKKYEVLALLYHEPPEDDKASQRQFEMEELILELAAQVLEDKGVGFGLVDSEKDAAVAKK
LGLTEVDSMYVFKGDEVIEYDGEFSADTIVEFLLDVLEDPVELIEGERELQAFENIEDEI
KLIGYFKSKDSEHYKAFEDAAEEFHPYIPFFATFDSKVAKKLTLKLNEIDFYEAFMEEPV
TIPDKPNSEEEIVNFVEEHRRSTLRKLKPESMYETWEDDMDGIHIVAFAEEADPDGFEFL
ETLKAVAQDNTENPDLSIIWIDPDDFPLLVPYWEKTFDIDLSAPQIGVVNVTDADSVWME
MDDEEDLPSAEELEDWLEDVLEGEINTEDDDDDDDD
Download sequence
Identical sequences P31415
gi|227430327|ref|NP_001222.3| ENSP00000357057 ENSP00000357057 NP_001222.3.87134 NP_001222.3.92137 ENSP00000357057

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]