SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|22748811|ref|NP_689590.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|22748811|ref|NP_689590.1|
Domain Number 1 Region: 188-269,319-385
Classification Level Classification E-value
Superfamily EF-hand 0.00000000000797
Family Calmodulin-like 0.043
Further Details:      
 
Weak hits

Sequence:  gi|22748811|ref|NP_689590.1|
Domain Number - Region: 470-528
Classification Level Classification E-value
Superfamily EF-hand 0.0342
Family Penta-EF-hand proteins 0.078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|22748811|ref|NP_689590.1|
Sequence length 546
Comment hypothetical protein LOC127795 [Homo sapiens]
Sequence
MSSAWKTPRGSDAMPEIMVKIIGSKHFQYLVEKPKIKENDSLKTETQTMHQKPMTDNARQ
MSRDTPVPINFTDQQTTDNPDDVKEKKHPENNQKSENNQKLLTGANSSRFLDGNIPSQAN
VHCSSVPTGDQSLSYVHGIPRRKLRDWSLEQMVRGSSDQPEDIGQSPSGTTNEDAFLLAL
VRRELKSRPLSSNLLEKLQKELKILDPISSGFLLQSQLSRLFLKHEVPLQLPTVKILCQR
FSKRGSPEMVNYEKLLWFLNSAASDYPQQNKAAADLRKTESHGTHSQSTPPQHSSSQPEV
NRSLLEILKMALRTTNGRLNIDNLNLSFRKEDRSFSGCLPLPKVRAICGKHGLYLTLSLL
ETLLNHQDLGYQNEIKWQNFVEMLTRASSDLLSDLPTGKNEKKAPAPPMEPEVPEMSQSK
TEHMKTPEEELQPESSPAETSACKDPLKPLKIRPVSQPFVNPAVKNKAEECETWIDRFRK
LENALYLCDLSNTGVLEKERARRLIHNYNLIYNLSLSPQKIDQALRRFRSGENMLLEPAL
RYLKEL
Download sequence
Identical sequences Q8N0U7
ENSP00000360244 ENSP00000360244 ENSP00000360244 gi|22748811|ref|NP_689590.1| GO.34916 9606.ENSP00000360244 NP_689590.1.87134 NP_689590.1.92137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]