SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|22748823|ref|NP_689597.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|22748823|ref|NP_689597.1|
Domain Number - Region: 148-220
Classification Level Classification E-value
Superfamily PH domain-like 0.00101
Family TFIIH domain 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|22748823|ref|NP_689597.1|
Sequence length 341
Comment Bardet-Biedl syndrome 5 protein [Homo sapiens]
Sequence
MSVLDALWEDRDVRFDLSAQQMKTRPGEVLIDCLDSIEDTKGNNGDRGRLLVTNLRILWH
SLALSRVNVSVGYNCILNITTRTANSKLRGQTEALYILTKCNSTRFEFIFTNLVPGSPRL
FTSVMAVHRAYETSKMYRDFKLRSALIQNKQLRLLPQEHVYDKINGVWNLSSDQGNLGTF
FITNVRIVWHANMNDSFNVSIPYLQIRSIKIRDSKFGLALVIESSQQSGGYVLGFKIDPV
EKLQESVKEINSLHKVYSASPIFGVDYEMEEKPQPLEALTVEQIQDDVEIDSDGHTDAFV
AYFADGNKQQDREPVFSEELGLAIEKLKDGFTLQGLWEVMS
Download sequence
Identical sequences A0A0S2Z626 K7CV40 Q8N3I7
NP_689597.1.87134 NP_689597.1.92137 XP_008976293.1.60992 XP_515883.2.37143 ENSP00000295240 ENSP00000295240 9598.ENSPTRP00000021547 9606.ENSP00000295240 gi|22748823|ref|NP_689597.1| GO.34773

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]