SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|22749197|ref|NP_689794.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|22749197|ref|NP_689794.1|
Domain Number 1 Region: 85-250
Classification Level Classification E-value
Superfamily CRAL/TRIO domain 4.05e-39
Family CRAL/TRIO domain 0.0022
Further Details:      
 
Domain Number 2 Region: 319-457
Classification Level Classification E-value
Superfamily PapD-like 1.44e-37
Family MSP-like 0.000000217
Further Details:      
 
Domain Number 3 Region: 35-83
Classification Level Classification E-value
Superfamily CRAL/TRIO N-terminal domain 0.00000288
Family CRAL/TRIO N-terminal domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|22749197|ref|NP_689794.1|
Sequence length 518
Comment motile sperm domain-containing protein 2 isoform 1 [Homo sapiens]
Sequence
MAENHAQNKAKLISETRRRFEAEYVTDKSDKYDARDVERLQQDDNWVESYLSWRHNIVDE
TLKMLDESFQWRKEISVNDLNESSIPRWLLEIGVIYLHGYDKEGNKLFWIRVKYHVKDQK
TILDKKKLIAFWLERYAKRENGKPVTVMFDLSETGINSIDMDFVRFIINCFKVYYPKYLS
KIVIFDMPWLMNAAFKIVKTWLGPEAVSLLKFTSKNEVQDYVSVEYLPPHMGGTDPFKYS
YPPLVDDDFQTPLCENGPITSEDETSSKEDIESDGKETLETISNEEQTPLLKKINPTEST
SKAEENEKVDSKVKAFKKPLSVFKGPLLHISPAEELYFGSTESGEKKTLIVLTNVTKNIV
AFKVRTTAPEKYRVKPSNSSCDPGASVDIVVSPHGGLTVSAQDRFLIMAAEMEQSSGTGP
AELTQFWKEVPRNKVMEHRLRCHTVESSKPNTLTLKDNAFNMSDKTSEDICLQLSRLLES
NRKLEDQVQRCIWFQQLLLSLTMLLLAFVTSFFYLLYS
Download sequence
Identical sequences Q8NHP6
9606.ENSP00000369860 gi|22749197|ref|NP_689794.1| ENSP00000369860 ENSP00000369860 ENSP00000369860 NP_689794.1.87134 NP_689794.1.92137 GO.34885

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]