SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|22749297|ref|NP_689848.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|22749297|ref|NP_689848.1|
Domain Number 1 Region: 179-227
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000821
Family EGF-type module 0.017
Further Details:      
 
Domain Number 2 Region: 220-268
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000247
Family EGF-type module 0.017
Further Details:      
 
Weak hits

Sequence:  gi|22749297|ref|NP_689848.1|
Domain Number - Region: 144-189
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000548
Family EGF-type module 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|22749297|ref|NP_689848.1|
Sequence length 545
Comment oncoprotein-induced transcript 3 protein precursor [Homo sapiens]
Sequence
MPPFLLLTCLFITGTSVSPVALDPCSAYISLNEPWRNTDHQLDESQGPPLCDNHVNGEWY
HFTGMAGDAMPTFCIPENHCGTHAPVWLNGSHPLEGDGIVQRQACASFNGNCCLWNTTVE
VKACPGGYYVYRLTKPSVCFHVYCGHFYDICDEDCHGSCSDTSECTCAPGTVLGPDRQTC
FDENECEQNNGGCSEICVNLKNSYRCECGVGRVLRSDGKTCEDVEGCHNNNGGCSHSCLG
SEKGYQCECPRGLVLSEDNHTCQVPVLCKSNAIEVNIPRELVGGLELFLTNTSCRGVSNG
THVNILFSLKTCGTVVDVVNDKIVASNLVTGLPKQTPGSSGDFIIRTSKLLIPVTCEFPR
LYTISEGYVPNLRNSPLEIMSRNHGIFPFTLEIFKDNEFEEPYREALPTLKLRDSLYFGI
EPVVHVSGLESLVESCFATPTSKIDEVLKYYLIRDGCVSDDSVKQYTSRDHLAKHFQVPV
FKFVGKDHKEVFLHCRVLVCGVLDERSRCAQGCHRRMRRGAGGEDSAGLQGQTLTGGPIR
IDWED
Download sequence
Identical sequences Q8WWZ8
NYSGRC-22749297 ENSP00000333900 9606.ENSP00000333900 ENSP00000333900 NP_689848.1.87134 NP_689848.1.92137 gi|22749297|ref|NP_689848.1| ENSP00000333900

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]