SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|22749443|ref|NP_689939.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|22749443|ref|NP_689939.1|
Domain Number 1 Region: 175-201,252-275,310-393
Classification Level Classification E-value
Superfamily EF-hand 0.00000000000839
Family Calmodulin-like 0.045
Further Details:      
 
Domain Number 2 Region: 88-260
Classification Level Classification E-value
Superfamily EF-hand 0.0000000000733
Family Calmodulin-like 0.023
Further Details:      
 
Weak hits

Sequence:  gi|22749443|ref|NP_689939.1|
Domain Number - Region: 17-84
Classification Level Classification E-value
Superfamily ClpP/crotonase 0.0168
Family Crotonase-like 0.043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|22749443|ref|NP_689939.1|
Sequence length 434
Comment EF-hand domain-containing family member A1 [Homo sapiens]
Sequence
MAAAAGSCARVAAWGGKLRRGLAVSRQAVRSPGPLAAAVAGAALAGAGAAWHHSRVSVAA
RDGSFTVSAQKNVEHGIIYIGKPSLRKQRFMQFSSLEHEGEYYMTPRDFLFSVMFEQMER
KTSVKKLTKKDIEDTLSGIQTAGCGSTFFRDLGDKGLISYTEYLFLLTILTKPHSGFHVA
FKMLDTDGNEMIEKREFFKLQKIISKQDDLMTVKTNETGYQEAIVKEPEINTTLQMRFFG
KRGQRKLHYKEFRRFMENLQTEIQEMEFLQFSKGLSFMRKEDFAEWLLFFTNTENKDIYW
KNVREKLSAGESISLDEFKSFCHFTTHLEDFAIAMQMFSLAHRPVRLAEFKRAVKVATGQ
ELSNNILDTVFKIFDLDGDECLSHEEFLGVLKNRMHRGLWVPQHQSIQEYWKCVKKESIK
GVKEVWKQAGKGLF
Download sequence
Identical sequences A0A0S2Z6V5 Q8IYU8
gi|22749443|ref|NP_689939.1| HR6565 NYSGRC-22749443 NP_689939.1.87134 NP_689939.1.92137 ENSP00000371811 ENSP00000371811 9606.ENSP00000371811 ENSP00000371811

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]