SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|228008343|ref|NP_001153114.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|228008343|ref|NP_001153114.1|
Domain Number 1 Region: 118-256
Classification Level Classification E-value
Superfamily CRAL/TRIO domain 2.88e-17
Family CRAL/TRIO domain 0.0087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|228008343|ref|NP_001153114.1|
Sequence length 275
Comment bcl-2/adenovirus E1B 19 kDa-interacting protein 2-like protein isoform b [Homo sapiens]
Sequence
MRKRLSAPELRLSLTKGPGNDGASPTQSAPSSPDGSSDLEIDELETPSDSEQLDSGHEFE
WEDELPRAEGLGTSETAERLGRGCMWDVTGEDGHHWRVFRMGPREQRVDMTVIEPYKKVL
SHGGYHGDGLNAVILFASCYLPRSSIPNYTYVMEHLFRYMVGTLELLVAENYLLVHLSGG
TSRAQVPPLSWIRQCYRTLDRRLRKNLRALVVVHATWYVKAFLALLRPFISSKFTRKIRF
LDSLGELAQLISLDQVHIPEAVRQLDRDLHGSGGT
Download sequence
Identical sequences ENSP00000295294 ENSP00000295294 GO.43022 NP_001153114.1.87134 NP_001153114.1.92137 gi|228008343|ref|NP_001153114.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]