SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|23065544|ref|NP_000552.2| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|23065544|ref|NP_000552.2|
Domain Number 1 Region: 86-217
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 8.21e-47
Family Glutathione S-transferase (GST), C-terminal domain 0.0007
Further Details:      
 
Domain Number 2 Region: 3-85
Classification Level Classification E-value
Superfamily Thioredoxin-like 3.18e-36
Family Glutathione S-transferase (GST), N-terminal domain 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|23065544|ref|NP_000552.2|
Sequence length 218
Comment glutathione S-transferase Mu 1 isoform 1 [Homo sapiens]
Sequence
MPMILGYWDIRGLAHAIRLLLEYTDSSYEEKKYTMGDAPDYDRSQWLNEKFKLGLDFPNL
PYLIDGAHKITQSNAILCYIARKHNLCGETEEEKIRVDILENQTMDNHMQLGMICYNPEF
EKLKPKYLEELPEKLKLYSEFLGKRPWFAGNKITFVDFLVYDVLDLHRIFEPKCLDAFPN
LKDFISRFEGLEKISAYMKSSRFLPRPVFSKMAVWGNK
Download sequence
Identical sequences P09488 X5DR03
1xw6A ENSP00000311469 9606.ENSP00000311469 ENSP00000311469 gi|23065544|ref|NP_000552.2| NP_000552.2.92137 1xw6_A 1xw6_B 1xw6_C 1xw6_D 1xwk_A 1xwk_B 1xwk_C 1yj6_A 1yj6_B 1yj6_C 2f3m_A 2f3m_B 2f3m_C 2f3m_D 2f3m_E 2f3m_F

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]