SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|23065547|ref|NP_666533.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|23065547|ref|NP_666533.1|
Domain Number 1 Region: 86-180
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 1.89e-23
Family Glutathione S-transferase (GST), C-terminal domain 0.0000025
Further Details:      
 
Domain Number 2 Region: 3-85
Classification Level Classification E-value
Superfamily Thioredoxin-like 2.15e-23
Family Glutathione S-transferase (GST), N-terminal domain 0.00000747
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|23065547|ref|NP_666533.1|
Sequence length 181
Comment glutathione S-transferase Mu 1 isoform 2 [Homo sapiens]
Sequence
MPMILGYWDIRGLAHAIRLLLEYTDSSYEEKKYTMGDAPDYDRSQWLNEKFKLGLDFPNL
PYLIDGAHKITQSNAILCYIARKHNLCGETEEEKIRVDILENQTMDNHMQLGMICYNPEF
EKLKPKYLEELPEKLKLYSEFLGKRPWFAGNKGLEKISAYMKSSRFLPRPVFSKMAVWGN
K
Download sequence
Identical sequences X5D932
ENSP00000234981 NP_666533.1.92137 gi|23065547|ref|NP_666533.1| ENSP00000234981

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]