SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|23065552|ref|NP_000840.2| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|23065552|ref|NP_000840.2|
Domain Number 1 Region: 90-221
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 4.87e-44
Family Glutathione S-transferase (GST), C-terminal domain 0.000000138
Further Details:      
 
Domain Number 2 Region: 7-89
Classification Level Classification E-value
Superfamily Thioredoxin-like 7.64e-22
Family Glutathione S-transferase (GST), N-terminal domain 0.00000956
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|23065552|ref|NP_000840.2|
Sequence length 225
Comment glutathione S-transferase Mu 3 [Homo sapiens]
Sequence
MSCESSMVLGYWDIRGLAHAIRLLLEFTDTSYEEKRYTCGEAPDYDRSQWLDVKFKLDLD
FPNLPYLLDGKNKITQSNAILRYIARKHNMCGETEEEKIRVDIIENQVMDFRTQLIRLCY
SSDHEKLKPQYLEELPGQLKQFSMFLGKFSWFAGEKLTFVDFLTYDILDQNRIFDPKCLD
EFPNLKAFMCRFEALEKIAAYLQSDQFCKMPINNKMAQWGNKPVC
Download sequence
Identical sequences P21266 Q6FGJ9
ENSP00000256594 ENSP00000354357 ENSP00000444978 ENSP00000256594 9606.ENSP00000256594 NP_000840.2.87134 NP_000840.2.92137 ENSP00000256594 ENSP00000354357 gi|23065552|ref|NP_000840.2|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]