SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|23065563|ref|NP_000842.2| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|23065563|ref|NP_000842.2|
Domain Number 1 Region: 86-217
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 7.1e-43
Family Glutathione S-transferase (GST), C-terminal domain 0.000000688
Further Details:      
 
Domain Number 2 Region: 3-85
Classification Level Classification E-value
Superfamily Thioredoxin-like 3.77e-23
Family Glutathione S-transferase (GST), N-terminal domain 0.0000106
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|23065563|ref|NP_000842.2|
Sequence length 218
Comment glutathione S-transferase Mu 5 [Homo sapiens]
Sequence
MPMTLGYWDIRGLAHAIRLLLEYTDSSYVEKKYTLGDAPDYDRSQWLNEKFKLGLDFPNL
PYLIDGAHKITQSNAILRYIARKHNLCGETEEEKIRVDILENQVMDNHMELVRLCYDPDF
EKLKPKYLEELPEKLKLYSEFLGKRPWFAGDKITFVDFLAYDVLDMKRIFEPKCLDAFLN
LKDFISRFEGLKKISAYMKSSQFLRGLLFGKSATWNSK
Download sequence
Identical sequences P46439 Q5T8R2
9606.ENSP00000256593 ENSP00000256593 NP_000842.2.87134 NP_000842.2.92137 XP_005270841.1.92137 ENSP00000256593 gi|23065563|ref|NP_000842.2|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]