SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|23308553|ref|NP_694568.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|23308553|ref|NP_694568.1|
Domain Number 1 Region: 228-445
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 9.55e-60
Family DBL homology domain (DH-domain) 0.0000000651
Further Details:      
 
Domain Number 2 Region: 431-584
Classification Level Classification E-value
Superfamily PH domain-like 4.29e-47
Family Pleckstrin-homology domain (PH domain) 0.00000212
Further Details:      
 
Domain Number 3 Region: 129-255
Classification Level Classification E-value
Superfamily SH3-domain 3.41e-24
Family SH3-domain 0.00083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|23308553|ref|NP_694568.1|
Sequence length 652
Comment spermatogenesis-associated protein 13 isoform 2 [Homo sapiens]
Sequence
MTSASPEDQNAPVGCPKGARRRRPISVIGGVSLYGTNQTEELDNLLTQPASRPPMPAHQV
PPYKAVSARFRPFTFSQSTPIGLDRVGRRRQMRASNVSSDGGTEPSALVDDNGSEEDFSY
EDLCQASPRYLQPGGEQLAINELISDGNVVCAEALWDHVTMDDQELGFKAGDVIQVLEAS
NKDWWWGRSEDKEAWFPASFVRLRVNQEELSENSSSTPSEEQDEEASQSRHRHCENKQQM
RTNVIREIMDTERVYIKHLRDICEGYIRQCRKHTGMFTVAQLATIFGNIEDIYKFQRKFL
KDLEKQYNKEEPHLSEIGSCFLQNQEGFAIYSEYCNNHPGACLELANLMKQGKYRHFFEA
CRLLQQMIDIAIDGFLLTPVQKICKYPLQLAELLKYTTQEHGDYSNIKAAYEAMKNVACL
INERKRKLESIDKIARWQVSIVGWEGLDILDRSSELIHSGELTKITKQGKSQQRTFFLFD
HQLVSCKKDLLRRDMLYYKGRLDMDEMELVDLGDGRDKDCNLSVKNAFKLVSRTTDEVYL
FCAKKQEDKARWLQACADERRRVQEDKEMGMEISENQKKLAMLNAQKAGHGKSKGYNRCP
VAPPHQGLHPIHQRHITMPTSVPQQQVFGLAEPKRKSSLFWHTFNRLTPFRK
Download sequence
Identical sequences A0A024RDM6 Q96N96
NP_694568.1.87134 NP_694568.1.92137 gi|23308553|ref|NP_694568.1| ENSP00000371527 ENSP00000371527 hso003016779.1 9606.ENSP00000371527

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]