SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|23312374|ref|NP_689410.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|23312374|ref|NP_689410.1|
Domain Number 1 Region: 95-475
Classification Level Classification E-value
Superfamily Metallo-dependent phosphatases 5.93e-91
Family Protein serine/threonine phosphatase 0.000000755
Further Details:      
 
Domain Number 2 Region: 457-615
Classification Level Classification E-value
Superfamily EF-hand 2.35e-27
Family Calmodulin-like 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|23312374|ref|NP_689410.1|
Sequence length 625
Comment serine/threonine-protein phosphatase with EF-hands 1 isoform 1b [Homo sapiens]
Sequence
MGCSSSSTKTRRSDTSLRAALIIQNWYRGYKARLKARQHYALTIFQSIEYADEQGQMQLS
TFFSFMLENYTHIHKEELELRNQSLESEQDMRDRWDYVDSIDVPDSYNGPRLQFPLTCTD
IDLLLEAFKEQQILHAHYVLEVLFETKKVLKQMPNFTHIQTSPSKEVTICGDLHGKLDDL
FLIFYKNGLPSERNPYVFNGDFVDRGKNSIEILMILCVSFLVYPNDLHLNRGNHEDFMMN
LRYGFTKEILHKYKLHGKRILQILEEFYAWLPIGTIVDNEILVIHGGISETTDLNLLHRV
ERNKMKSVLIPPTETNRDHDTDSKHNKIIDILWSDPRGKNGCFPNTCRGGGCYFGPDVTS
KILNKYQLKMLIRSHECKPEGYEICHDGKVVTIFSASNYYEEGSNRGAYIKLCSGTTPRF
FQYQVTKATCFQPLRQRVDTMENSAIKILRERVISRKSDLTRAFQLQDHRKSGKLSVSQW
AFCMENILGLNLPWRSLSSNLVNIDQNGNVEYMSSFQNIRIEKPVQEAHSTLVETLYRYR
SDLEIIFNAIDTDHSGLISVEEFRAMWKLFSSHYNVHIDDSQVNKLANIMDLNKDGSIDF
NEFLKAFYVVHRYEDLMKPDVTNLG
Download sequence
Identical sequences gi|23312374|ref|NP_689410.1| NP_689410.1.87134 NP_689410.1.92137 NYSGXRC-8710a

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]