SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|23397681|ref|NP_038475.2| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|23397681|ref|NP_038475.2|
Domain Number 1 Region: 84-197
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000165
Family Growth factor receptor domain 0.02
Further Details:      
 
Domain Number 2 Region: 206-246
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000039
Family EGF-type module 0.012
Further Details:      
 
Weak hits

Sequence:  gi|23397681|ref|NP_038475.2|
Domain Number - Region: 516-811
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 0.0054
Family Rhodopsin-like 0.025
Further Details:      
 
Domain Number - Region: 29-102
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0155
Family Growth factor receptor domain 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|23397681|ref|NP_038475.2|
Sequence length 823
Comment EGF-like module-containing mucin-like hormone receptor-like 2 isoform a [Homo sapiens]
Sequence
MGGRVFLVFLAFCVWLTLPGAETQDSRGCARWCPQDSSCVNATACRCNPGFSSFSEIITT
PMETCDDINECATLSKVSCGKFSDCWNTEGSYDCVCSPGYEPVSGAKTFKNESENTCQDV
DECQQNPRLCKSYGTCVNTLGSYTCQCLPGFKLKPEDPKLCTDVNECTSGQNPCHSSTHC
LNNVGSYQCRCRPGWQPIPGSPNGPNNTVCEDVDECSSGQHQCDSSTVCFNTVGSYSCRC
RPGWKPRHGIPNNQKDTVCEDMTFSTWTPPPGVHSQTLSRFFDKVQDLGRDYKPGLANNT
IQSILQALDELLEAPGDLETLPRLQQHCVASHLLDGLEDVLRGLSKNLSNGLLNFSYPAG
TELSLEVQKQVDRSVTLRQNQAVMQLDWNQAQKSGDPGPSVVGLVSIPGMGKLLAEAPLV
LEPEKQMLLHETHQGLLQDGSPILLSDVISAFLSNNDTQNLSSPVTFTFSHRSVIPRQKV
LCVFWEHGQNGCGHWATTGCSTIGTRDTSTICRCTHLSSFAVLMAHYDVQEEDPVLTVIT
YMGLSVSLLCLLLAALTFLLCKAIQNTSTSLHLQLSLCLFLAHLLFLVAIDQTGHKVLCS
IIAGTLHYLYLATLTWMLLEALYLFLTARNLTVVNYSSINRFMKKLMFPVGYGVPAVTVA
ISAASRPHLYGTPSRCWLQPEKGFIWGFLGPVCAIFSVNLVLFLVTLWILKNRLSSLNSE
VSTLRNTRMLAFKATAQLFILGCTWCLGILQVGPAARVMAYLFTIINSLQGVFIFLVYCL
LSQQVREQYGKWSKGIRKLKTESEMHTLSSSAKADTSKPSTVN
Download sequence
Identical sequences Q9UHX3
ENSP00000319883 ENSP00000376689 NP_038475.2.87134 NP_038475.2.92137 gi|23397681|ref|NP_038475.2| ENSP00000319883 9606.ENSP00000319883

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]