SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|237649019|ref|NP_001153682.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|237649019|ref|NP_001153682.1|
Domain Number 1 Region: 329-604
Classification Level Classification E-value
Superfamily Mitochondrial carrier 1.96e-79
Family Mitochondrial carrier 0.0000436
Further Details:      
 
Domain Number 2 Region: 11-157
Classification Level Classification E-value
Superfamily EF-hand 1.46e-19
Family Calbindin D9K 0.074
Further Details:      
 
Domain Number 3 Region: 159-278
Classification Level Classification E-value
Superfamily EF-hand 0.0000000286
Family Calmodulin-like 0.051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|237649019|ref|NP_001153682.1|
Sequence length 676
Comment calcium-binding mitochondrial carrier protein Aralar2 isoform 1 [Homo sapiens]
Sequence
MAAAKVALTKRADPAELRTIFLKYASIEKNGEFFMSPNDFVTRYLNIFGESQPNPKTVEL
LSGVVDQTKDGLISFQEFVAFESVLCAPDALFMVAFQLFDKAGKGEVTFEDVKQVFGQTT
IHQHIPFNWDSEFVQLHFGKERKRHLTYAEFTQFLLEIQLEHAKQAFVQRDNARTGRVTA
IDFRDIMVTIRPHVLTPFVEECLVAAAGGTTSHQVSFSYFNGFNSLLNNMELIRKIYSTL
AGTRKDVEVTKEEFVLAAQKFGQVTPMEVDILFQLADLYEPRGRMTLADIERIAPLEEGT
LPFNLAEAQRQQKASGDSARPVLLQVAESAYRFGLGSVAGAVGATAVYPIDLVKTRMQNQ
RSTGSFVGELMYKNSFDCFKKVLRYEGFFGLYRGLLPQLLGVAPEKAIKLTVNDFVRDKF
MHKDGSVPLAAEILAGGCAGGSQVIFTNPLEIVKIRLQVAGEITTGPRVSALSVVRDLGF
FGIYKGAKACFLRDIPFSAIYFPCYAHVKASFANEDGQVSPGSLLLAGAIAGMPAASLVT
PADVIKTRLQVAARAGQTTYSGVIDCFRKILREEGPKALWKGAGARVFRSSPQFGVTLLT
YELLQRWFYIDFGGVKPMGSEPVPKSRINLPAPNPDHVGGYKLAVATFAGIENKFGLYLP
LFKPSVSTSKAIGGGP
Download sequence
Identical sequences A0A2J8L4F2 A0A2J8WJM1
gi|237649019|ref|NP_001153682.1| ENSP00000400101 ENSP00000400101 ENSP00000400101 NP_001153682.1.87134 NP_001153682.1.92137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]