SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|237820624|ref|NP_001153656.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|237820624|ref|NP_001153656.1|
Domain Number 1 Region: 70-190
Classification Level Classification E-value
Superfamily PH domain-like 4.11e-20
Family Pleckstrin-homology domain (PH domain) 0.0072
Further Details:      
 
Domain Number 2 Region: 228-330
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000000000188
Family Pleckstrin-homology domain (PH domain) 0.004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|237820624|ref|NP_001153656.1|
Sequence length 576
Comment pleckstrin homology domain-containing family N member 1 isoform b [Homo sapiens]
Sequence
MGNSHCVPQAPRRLRASFSRKPSLKGNREDSARMSAGLPGPEAARSGDAAANKLFHYIPG
TDILDLENQRENLEQPFLSVFKKGRRRVPVRNLGKVVHYAKVQLRFQHSQDVSDCYLELF
PAHLYFQAHGSEGLTFQGLLPLTELSVCPLEGSREHAFQITGPLPAPLLVLCPSRAELDR
WLYHLEKQTALLGGPRRCHSAPPQGSCGDELPWTLQRRLTRLRTASGHEPGGSAVCASRV
KLQHLPAQEQWDRLLVLYPTSLAIFSEELDGLCFKGELPLRAVHINLEEKEKQIRSFLIE
GPLINTIRVVCASYEDYGHWLLCLRAVTHREGAPPLPGAESFPGSQVMGSGRGSLSSGGQ
TSWDSGCLAPPSTRTSHSLPESSVPSTVGCSSQHTPLHRLSLESSPDAPDHTSETSHSPL
YADPYTPPATSHRRVTDVRGLEEFLSAMQSARGPTPSSPLPSVPVSVPASDPRSCSSGPA
GPYLLSKKGALQSRAAQRHRGSAKDGGPQPPDAPQLVSSAREGSPEPWLPLTDGRSPRRS
RDPGYDHLWDETLSSSHQKCPQLGGPEASGGLVQWI
Download sequence
Identical sequences ENSP00000368717 gi|237820624|ref|NP_001153656.1| ENSP00000368717 NP_001153656.1.87134 NP_001153656.1.92137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]