SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|238624167|ref|NP_001154840.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|238624167|ref|NP_001154840.1|
Domain Number 1 Region: 78-272
Classification Level Classification E-value
Superfamily CRAL/TRIO domain 1.18e-58
Family CRAL/TRIO domain 0.0000000835
Further Details:      
 
Domain Number 2 Region: 2-74
Classification Level Classification E-value
Superfamily CRAL/TRIO N-terminal domain 1.7e-21
Family CRAL/TRIO N-terminal domain 0.0000239
Further Details:      
 
Domain Number 3 Region: 277-360
Classification Level Classification E-value
Superfamily Supernatant protein factor (SPF), C-terminal domain 4.05e-21
Family Supernatant protein factor (SPF), C-terminal domain 0.0000164
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|238624167|ref|NP_001154840.1|
Sequence length 360
Comment SEC14-like protein 4 isoform b [Homo sapiens]
Sequence
MSSRVGDLSPQQQEALARFRENLQDLLPILPNADDYFLLRWLRARNFDLQKSEDMLRRHM
EFRKQQDLDNIVTWQPPEVIQLYDSGGLCGYDYEGCPVYFNIIGSLDPKGLLLSASKQDM
IRKRIKVCELLLHECELQTQKLGRKIEMALMVFDMEGLSLKHLWKPAVEVYQQFFSILEA
NYPETLKNLIVIRAPKLFPVAFNLVKSFMSEETRRKIVILGDNWKQELTKFISPDQLPVE
FGGTMTDPDGNPKCLTKINYGGEVPKSYYLCEQVRLQYEHTRSVGRGSSLQVENEILFPG
CVLRWQFASDGGDIGFGVFLKTKMGEQQSAREMTEVLPSQRYNAHMVPEDGSLTCLQAGV
Download sequence
Identical sequences NP_001154840.1.87134 NP_001154840.1.92137 ENSP00000371412 gi|238624167|ref|NP_001154840.1| ENSP00000371412

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]