SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|238859647|ref|NP_116176.2| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|238859647|ref|NP_116176.2|
Domain Number 1 Region: 451-740
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 0.0000000613
Family Rhodopsin-like 0.018
Further Details:      
 
Weak hits

Sequence:  gi|238859647|ref|NP_116176.2|
Domain Number - Region: 50-76
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0147
Family Integrin beta EGF-like domains 0.058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|238859647|ref|NP_116176.2|
Sequence length 797
Comment probable G-protein coupled receptor 128 precursor [Homo sapiens]
Sequence
MASCRAWNLRVLVAVVCGLLTGIILGLGIWRIVIRIQRGKSTSSSSTPTEFCRNGGTWEN
GRCICTEEWKGLRCTIANFCENSTYMGFTFARIPVGRYGPSLQTCGKDTPNAGNPMAVRL
CSLSLYGEIELQKVTIGNCNENLETLEKQVKDVTAPLNNISSEVQILTSDANKLTAENIT
SATRVVGQIFNTSRNASPEAKKVAIVTVSQLLDASEDAFQRVAATANDDALTTLIEQMET
YSLSLGNQSVVEPNIAIQSANFSSENAVGPSNVRFSVQKGASSSLVSSSTFIHTNVDGLN
PDAQTELQVLLNMTKNYTKTCGFVVYQNDKLFQSKTFTAKSDFSQKIISSKTDENEQDQS
ASVDMVFSPKYNQKEFQLYSYACVYWNLSAKDWDTYGCQKDKGTDGFLRCRCNHTTNFAV
LMTFKKDYQYPKSLDILSNVGCALSVTGLALTVIFQIVTRKVRKTSVTWVLVNLCISMLI
FNLLFVFGIENSNKNLQTSDGDINNIDFDNNDIPRTDTINIPNPMCTAIAALLHYFLLVT
FTWNALSAAQLYYLLIRTMKPLPRHFILFISLIGWGVPAIVVAITVGVIYSQNGNNPQWE
LDYRQEKICWLAIPEPNGVIKSPLLWSFIVPVTIILISNVVMFITISIKVLWKNNQNLTS
TKKVSSMKKIVSTLSVAVVFGITWILAYLMLVNDDSIRIVFSYIFCLFNTTQGLQIFILY
TVRTKVFQSEASKVLMLLSSIGRRKSLPSVTRPRLRVKMYNFLRSLPTLHERFRLLETSP
STEEITLSESDNAKESI
Download sequence
Identical sequences Q96K78
9606.ENSP00000273352 ENSP00000273352 gi|238859647|ref|NP_116176.2| ENSP00000273352 NP_116176.2.87134 NP_116176.2.92137 ENSP00000273352

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]