SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|238908495|ref|NP_001154970.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|238908495|ref|NP_001154970.1|
Domain Number 1 Region: 20-144
Classification Level Classification E-value
Superfamily PH domain-like 2.39e-19
Family Pleckstrin-homology domain (PH domain) 0.066
Further Details:      
 
Weak hits

Sequence:  gi|238908495|ref|NP_001154970.1|
Domain Number - Region: 290-413
Classification Level Classification E-value
Superfamily Tropomyosin 0.0049
Family Tropomyosin 0.011
Further Details:      
 
Domain Number - Region: 178-272
Classification Level Classification E-value
Superfamily Oxygen-evolving enhancer protein 3, 0.0144
Family Oxygen-evolving enhancer protein 3, 0.0059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|238908495|ref|NP_001154970.1|
Sequence length 506
Comment pleckstrin homology domain containing, family D (with M protein repeats) member 1 [Homo sapiens]
Sequence
MFTSKSNSVSPSPSLEQADSDALDISTKVQLYGVLWKRPFGRPSAKWSRRFFIIKESFLL
YYSESEKKSFETNKYFNIHPKGVIPLGGCLVEPKEEPSMPYAMKISHQDFHGNILLAAES
EFEQTQWLEMLQESGKVTWKNAQLGEAMIKSLEAQGLQLAKEKQEYLDKLMEETEELCLQ
REQREELERLNQVLEAEKQQFEEVVQELRMEQEQIKRELELTARCLKGVEQEKKELRHLT
ESLQQTLEELSIEKKKTLEMLEENENHLQTLANQSEQPPPSGGLHSNLRQIEEKMQQLLE
EKLLAEKRMKENEERSRALEEEREFYSSQSQALQNSLQELTAEKQQAERELKAEVKVRMD
LERRLREAEGALRSLEQGLNSKVRNKEKEERMRADVSHLKRFFEECIRNAELEAKMPVIM
KNSVYIHKAATRRIKSCRFHRRRSSTSWNDMKPSQSFMTSQLDANNMEELKEVAKRLSRD
QRFRESIYHIMATQPGAPSALSRGGK
Download sequence
Identical sequences A6NEE1
ENSP00000317175 NP_001154970.1.87134 NP_001154970.1.92137 gi|238908495|ref|NP_001154970.1| 9606.ENSP00000317175 ENSP00000317175 ENSP00000317175

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]