SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|238908508|ref|NP_001155000.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|238908508|ref|NP_001155000.1|
Domain Number 1 Region: 416-748
Classification Level Classification E-value
Superfamily L domain-like 2.38e-62
Family Internalin LRR domain 0.0058
Further Details:      
 
Domain Number 2 Region: 145-451
Classification Level Classification E-value
Superfamily L domain-like 4.68e-56
Family Leucine rich effector protein YopM 0.032
Further Details:      
 
Weak hits

Sequence:  gi|238908508|ref|NP_001155000.1|
Domain Number - Region: 758-850
Classification Level Classification E-value
Superfamily DEATH domain 0.000194
Family DEATH domain, DD 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|238908508|ref|NP_001155000.1|
Sequence length 860
Comment leucine-rich repeat and death domain-containing protein 1 [Homo sapiens]
Sequence
MSEKEGMSEVLEDTISQFRKESRSQSMKEPGFIKETSNLINEASDYLEGKSSNQIYETHP
RQNTLESTSSSGRKSKRNEEQKKNLQFSETSTRTGTSQSLSSLTGRTAEYQALVNFLSHE
TVGEVSPQVSEENQKQLGLGADNFTVNLEAKGLQEFPKDILKIKYVKYLYLDKNQIKTFQ
GADSGDLLGLEILSLQENGLSSLPSEIQLLHNLRILNVSHNHISHIPKEISQLGNIRQLF
FYNNYIENFPSDLECLGNLEILSLGKNKLRHIPDTLPSLKTLRVLNLEYNQLTTFPKALC
FLPKLISLDLTGNLISSLPKEIRELKNLETLLMDHNKLTFLAVEIFQLLKIKELQLADNK
LEVISHKIENFRELRILILDKNLLKNIPEKISCCAMLECLSLSDNKLTELPKYIHKLNNL
RKLHVNRNNMVKITDCISHLNNICSLEFSGNIITDVPIEIKNCQKIIKIELSYNKIMYFP
LGLCALDSLYYLSVNGNYISEIPVDISFSKQLLHLELSENKLLIFSEHFCSLINLKYLDL
GKNQIKKIPASISNMISLHVLILCCNKFETFPRELCTLENLQVLDLSENQLQKISSDICN
LKGIQKLNFSSNQFIHFPIELCQLQSLEQLNISQIKGRKLTRLPGELSNMTQLKELDISN
NAIREIPRNIGELRNLVSLHAYNNQISYLPPSLLSLNDLQQLNLSGNNLTALPSAIYNIF
SLKEINFDDNPLLRPPVEICKGKQLYTIARYLQRADERDEKILEKIFKIVANNITETNFE
FLCQKLNLANSETDMPTKSTVSLSERAHQALVIWKTQSNKLSLTAAALRDQLIRALTMIG
AYEIMDKITALNLFTRAIKF
Download sequence
Identical sequences A4D1F6
9606.ENSP00000411568 gi|238908508|ref|NP_001155000.1| ENSP00000405987 ENSP00000411568 NP_001155000.1.87134 NP_001155000.1.92137 ENSP00000405987 ENSP00000411568 ENSP00000387628

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]