SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|239582714|ref|NP_005815.2| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|239582714|ref|NP_005815.2|
Domain Number 1 Region: 63-194
Classification Level Classification E-value
Superfamily L domain-like 3.67e-28
Family Ngr ectodomain-like 0.011
Further Details:      
 
Domain Number 2 Region: 246-312
Classification Level Classification E-value
Superfamily L domain-like 0.00000000000553
Family Ngr ectodomain-like 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|239582714|ref|NP_005815.2|
Sequence length 313
Comment leucine-rich repeat-containing protein 17 isoform 2 [Homo sapiens]
Sequence
MRVVTIVILLCFCKAAELRKASPGSVRSRVNHGRAGGGRRGSNPVKRYAPGLPCDVYTYL
HEKYLDCQERKLVYVLPGWPQDLLHMLLARNKIRTLKNNMFSKFKKLKSLDLQQNEISKI
ESEAFFGLNKLTTLLLQHNQIKVLTEEVFIYTPLLSYLRLYDNPWHCTCEIETLISMLQI
PRNRNLGNYAKCESPQEQKNKKLRQIKSEQLCNEEEKEQLDPKPQVSGRPPVIKPEVDST
FCHNYVFPIQTLDCKRKELKKVPNNIPPDIVKLDLSYNKINQLRPKEFEDVHELKKLNLS
SNGIEFIDPGSLR
Download sequence
Identical sequences ENSP00000249377 NP_005815.2.87134 NP_005815.2.92137 ENSP00000249377 gi|239582714|ref|NP_005815.2|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]