SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|239735607|ref|NP_660326.2| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|239735607|ref|NP_660326.2|
Domain Number 1 Region: 6-99
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.0000000000667
Family Glutathione peroxidase-like 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|239735607|ref|NP_660326.2|
Sequence length 135
Comment nucleoredoxin-like protein 2 isoform 2 [Homo sapiens]
Sequence
MVDILGERHLVTCKGATVEAEAALQNKVVALYFAAARCAPSRDFTPLLCDFYTALVAEAR
RPAPFEVVFVSADGSSQEMLDFMRELHGAWLALPFHDPYRQRSLALLPRLECSGVILAHC
NLCLLGSSDSLALAS
Download sequence
Identical sequences ENSP00000365015 NP_660326.2.87134 NP_660326.2.92137 gi|239735607|ref|NP_660326.2| 9606.ENSP00000365015 ENSP00000365015

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]