SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|239744064|ref|XP_001714838.2| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|239744064|ref|XP_001714838.2|
Domain Number 1 Region: 467-579
Classification Level Classification E-value
Superfamily ArfGap/RecO-like zinc finger 6.02e-38
Family Pyk2-associated protein beta ARF-GAP domain 0.00056
Further Details:      
 
Domain Number 2 Region: 283-344,407-452
Classification Level Classification E-value
Superfamily PH domain-like 8.15e-20
Family Pleckstrin-homology domain (PH domain) 0.0085
Further Details:      
 
Domain Number 3 Region: 592-679
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.00000000000591
Family Ankyrin repeat 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|239744064|ref|XP_001714838.2|
Sequence length 684
Comment PREDICTED: LOW QUALITY PROTEIN: arf-GAP with GTPase, ANK repeat and PH domain-containing protein 10 [Homo sapiens]
Sequence
MGNILTCRVHPSVSLEFDQQQGSVCPSESEIYEAGAEDRMAGAPMAAAVQPAEVTVEVGE
DLHMHQVRDREMPEALEFNLSANPEASTIFQRNSQTDALEFNSSANPEASTIFQRNSQTD
VVEIRRSNCTNHVSTERFSQQYSSCSTIFLDDSTAIQHYLTMTIISVTLEIPHHITQRDA
DRSLSIPDEQLHSFAVSTVHIMKKRNGGGSLNNYSSSIPPTPSTSQEDPQFSVPPTANTP
TPVCKLSMRWSNLFTSEKGSDPDKERKAPENHADTIGSGRAIPIKQGMLLKRSGKWLKTW
KKKYVTLCSNGVLTYYSSLGDYMKNIHKKEIDLRTSTIKVPGKWPSLATSACAPISSSKS
NGLSKDMDTGLGDSICFSPGISSTTSPKLNPPPSPHANKKKHLKKKSTNNFMIVSATGQT
WHFEATTYEERDAWVQAIQSQILASLQSCKSSKSKSQLTSQSEAMALQSIQNMRGNAHCV
DCETQNPKWASLNLGVLMCIECSGIHRSFGTRLSRVRSLELDDWPVELRKVMSSIGNELA
NSIWEGSSQGQTKPSIKSTREEKEWWIRSKYEEKLFLAPLPCTELSLGQQLLRATTDEDL
QTAILLLAHGSREEVNETCGEGDGCTALHLACRKGNVVLEQLLXGVDVMARDAHGNTALT
YARQASSQECINVLLQYGCPDECV
Download sequence
Identical sequences gi|239744064|ref|XP_001714838.2|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]