SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|242247193|ref|NP_066189.3| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|242247193|ref|NP_066189.3|
Domain Number 1 Region: 221-354
Classification Level Classification E-value
Superfamily PH domain-like 5.63e-40
Family Pleckstrin-homology domain (PH domain) 0.000000858
Further Details:      
 
Domain Number 2 Region: 457-564
Classification Level Classification E-value
Superfamily SH2 domain 2.56e-24
Family SH2 domain 0.00000443
Further Details:      
 
Domain Number 3 Region: 64-124
Classification Level Classification E-value
Superfamily Phenylalanine zipper 1.57e-22
Family Adapter protein APS, dimerisation domain 0.0000182
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|242247193|ref|NP_066189.3|
Sequence length 675
Comment SH2B adapter protein 2 [Homo sapiens]
Sequence
MDPSYCPAHGFPSQDPLWPLSSQQWSSAHYSEPAAGGCDGTEAMNGAGPGPAAAAPVPVP
VPVPDWRQFCELHAQAAAVDFAHKFCRFLRDNPAYDTPDAGASFSRHFAANFLDVFGEEV
RRVLVAGPTTRGAAVSAEAMEPELADTSALKAAPYGHSRSSEDVSTHAATKARVRKGFSL
RNMSLCVVDGVRDMWHRRASPEPDAAAAPRTAEPRDKWTRRLRLSRTLAAKVELVDIQRE
GALRFMVADDAAAGSGGSAQWQKCRLLLRRAVAEERFRLEFFVPPKASRPKVSIPLSAII
EVRTTMPLEMPEKDNTFVLKVENGAEYILETIDSLQKHSWVADIQGCVDPGDSEEDTELS
CTRGGCLASRVASCSCELLTDAVDLPRPPETTAVGAVVTAPHSRGRDAVRESLIHVPLET
FLQTLESPGGSGSDSNNTGEQGAETDPEAEPELELSDYPWFHGTLSRVKAAQLVLAGGPR
NHGLFVIRQSETRPGEYVLTFNFQGKAKHLRLSLNGHGQCHVQHLWFQSVLDMLRHFHTH
PIPLESGGSADITLRSYVRAQDPPPEPGPTPPAAPASPACWSDSPGQHYFSSLAAAACPP
ASPSDAAGASSSSASSSSAASGPAPPRPVEGQLSARSRSNSAERLLEAVAATAAEEPPEA
APGRARAVENQYSFY
Download sequence
Identical sequences NP_066189.3.87134 NP_066189.3.92137 gi|242247193|ref|NP_066189.3|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]