SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|24307965|ref|NP_055422.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|24307965|ref|NP_055422.1|
Domain Number 1 Region: 257-395
Classification Level Classification E-value
Superfamily Ubiquitin-like 2.84e-26
Family UBX domain 0.0095
Further Details:      
 
Domain Number 2 Region: 3-109
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.00000000101
Family Thioltransferase 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|24307965|ref|NP_055422.1|
Sequence length 508
Comment UBX domain-containing protein 4 [Homo sapiens]
Sequence
MLWFQGAIPAAIATAKRSGAVFVVFVAGDDEQSTQMAASWEDDKVTEASSNSFVAIKIDT
KSEACLQFSQIYPVVCVPSSFFIGDSGIPLEVIAGSVSADELVTRIHKVRQMHLLKSETS
VANGSQSESSVSTPSASFEPNNTCENSQSRNAELCEIPPTSDTKSDTATGGESAGHATSS
QEPSGCSDQRPAEDLNIRVERLTKKLEERREEKRKEEEQREIKKEIERRKTGKEMLDYKR
KQEEELTKRMLEERNREKAEDRAARERIKQQIALDRAERAARFAKTKEEVEAAKAAALLA
KQAEMEVKRESYARERSTVARIQFRLPDGSSFTNQFPSDAPLEEARQFAAQTVGNTYGNF
SLATMFPRREFTKEDYKKKLLDLELAPSASVVLLPAGRPTASIVHSSSGDIWTLLGTVLY
PFLAIWRLISNFLFSNPPPTQTSVRVTSSEPPNPASSSKSEKREPVRKRVLEKRGDDFKK
EGKIYRLRTQDDGEDENNTWNGNSTQQM
Download sequence
Identical sequences G2HEJ3 Q92575
ENSP00000272638 ENSP00000272638 NP_001233439.1.37143 NP_055422.1.87134 NP_055422.1.92137 XP_003822863.1.60992 gi|24307965|ref|NP_055422.1| 9598.ENSPTRP00000042043 9606.ENSP00000272638 ENSP00000272638

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]