SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|24308127|ref|NP_061854.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|24308127|ref|NP_061854.1|
Domain Number 1 Region: 446-555
Classification Level Classification E-value
Superfamily Thioredoxin-like 3.53e-30
Family PDI-like 0.01
Further Details:      
 
Domain Number 2 Region: 121-233
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.83e-28
Family PDI-like 0.014
Further Details:      
 
Domain Number 3 Region: 669-779
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.14e-27
Family PDI-like 0.039
Further Details:      
 
Domain Number 4 Region: 33-125
Classification Level Classification E-value
Superfamily Chaperone J-domain 4.06e-26
Family Chaperone J-domain 0.00022
Further Details:      
 
Domain Number 5 Region: 553-652
Classification Level Classification E-value
Superfamily Thioredoxin-like 7.34e-25
Family PDI-like 0.026
Further Details:      
 
Domain Number 6 Region: 349-462
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.00000000000101
Family PDI-like 0.033
Further Details:      
 
Domain Number 7 Region: 234-345
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.0000607
Family PDI-like 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|24308127|ref|NP_061854.1|
Sequence length 793
Comment dnaJ homolog subfamily C member 10 precursor [Homo sapiens]
Sequence
MGVWLNKDDYIRDLKRIILCFLIVYMAILVGTDQDFYSLLGVSKTASSREIRQAFKKLAL
KLHPDKNPNNPNAHGDFLKINRAYEVLKDEDLRKKYDKYGEKGLEDNQGGQYESWNYYRY
DFGIYDDDPEIITLERREFDAAVNSGELWFVNFYSPGCSHCHDLAPTWRDFAKEVDGLLR
IGAVNCGDDRMLCRMKGVNSYPSLFIFRSGMAPVKYHGDRSKESLVSFAMQHVRSTVTEL
WTGNFVNSIQTAFAAGIGWLITFCSKGGDCLTSQTRLRLSGMLDGLVNVGWMDCATQDNL
CKSLDITTSTTAYFPPGATLNNKEKNSILFLNSLDAKEIYLEVIHNLPDFELLSANTLED
RLAHHRWLLFFHFGKNENSNDPELKKLKTLLKNDHIQVGRFDCSSAPDICSNLYVFQPSL
AVFKGQGTKEYEIHHGKKILYDILAFAKESVNSHVTTLGPQNFPANDKEPWLVDFFAPWC
PPCRALLPELRRASNLLYGQLKFGTLDCTVHEGLCNMYNIQAYPTTVVFNQSNIHEYEGH
HSAEQILEFIEDLMNPSVVSLTPTTFNELVTQRKHNEVWMVDFYSPWCHPCQVLMPEWKR
MARTLTGLINVGSIDCQQYHSFCAQENVQRYPEIRFFPPKSNKAYHYHSYNGWNRDAYSL
RIWGLGFLPQVSTDLTPQTFSEKVLQGKNHWVIDFYAPWCGPCQNFAPEFELLARMIKGK
VKAGKVDCQAYAQTCQKAGIRAYPTVKFYFYERAKRNFQEEQINTRDAKAIAALISEKLE
TLRNQGKRNKDEL
Download sequence
Identical sequences Q8IXB1
ENSP00000264065 ENSP00000264065 NP_061854.1.87134 NP_061854.1.92137 ENSP00000264065 gi|24308127|ref|NP_061854.1| 9606.ENSP00000264065

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]