SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|24308207|ref|NP_065761.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|24308207|ref|NP_065761.1|
Domain Number 1 Region: 42-244
Classification Level Classification E-value
Superfamily L domain-like 1.94e-37
Family Ngr ectodomain-like 0.069
Further Details:      
 
Weak hits

Sequence:  gi|24308207|ref|NP_065761.1|
Domain Number - Region: 445-493
Classification Level Classification E-value
Superfamily PheT/TilS domain 0.0209
Family B3/B4 domain of PheRS, PheT 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|24308207|ref|NP_065761.1|
Sequence length 583
Comment leucine-rich repeat-containing protein 47 [Homo sapiens]
Sequence
MAAAAVSESWPELELAERERRRELLLTGPGLEERVRAAGGQLPPRLFTLPLLHYLEVSGC
GSLRAPGPGLAQGLPQLHSLVLRRNALGPGLSPELGPLPALRVLDLSGNALEALPPGQGL
GPAEPPGLPQLQSLNLSGNRLRELPADLARCAPRLQSLNLTGNCLDSFPAELFRPGALPL
LSELAAADNCLRELSPDIAHLASLKTLDLSNNQLSEIPAELADCPKLKEINFRGNKLRDK
RLEKMVSGCQTRSILEYLRVGGRGGGKGKGRAEGSEKEESRRKRRERKQRREGGDGEEQD
VGDAGRLLLRVLHVSENPVPLTVRVSPEVRDVRPYIVGAVVRGMDLQPGNALKRFLTSQT
KLHEDLCEKRTAATLATHELRAVKGPLLYCARPPQDLKIVPLGRKEAKAKELVRQLQLEA
EEQRKQKKRQSVSGLHRYLHLLDGNENYPCLVDADGDVISFPPITNSEKTKVKKTTSDLF
LEVTSATSLQICKDVMDALILKMAEMKKYTLENKEEGSLSDTEADAVSGQLPDPTTNPSA
GKDGPSLLVVEQVRVVDLEGSLKVVYPSKADLATAPPHVTVVR
Download sequence
Identical sequences A0A024R4G1 Q8N1G4
9606.ENSP00000367498 NP_065761.1.87134 NP_065761.1.92137 ENSP00000367498 ENSP00000367498 ENSP00000367498 gi|24308207|ref|NP_065761.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]