SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|24308279|ref|NP_071746.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|24308279|ref|NP_071746.1|
Domain Number 1 Region: 249-337
Classification Level Classification E-value
Superfamily Dimeric alpha+beta barrel 1.16e-16
Family Hypothetical protein YjcS 0.067
Further Details:      
 
Domain Number 2 Region: 30-97
Classification Level Classification E-value
Superfamily EF-hand 0.00000000000888
Family Calmodulin-like 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|24308279|ref|NP_071746.1|
Sequence length 351
Comment N-terminal EF-hand calcium-binding protein 1 [Homo sapiens]
Sequence
MEDSQETSPSSNNSSEELSSALHLSKGMSIFLDILRRADKNDDGKLSFEEFKAYFADGVL
SGEELHELFHTIDTHNTNNLDTEELCEYFSQHLGEYENVLAALEDLNLSILKAMGKTKKD
YQEASNLEQFVTRFLLKETLNQLQSLQNSLECAMETTEEQTRQERQGPAKPEVLSIQWPG
KRSSRRVQRHNSFSPNSPQFNVSGPGLLEEDNQWMTQINRLQKLIDRLEKKDLKLEPPEE
EIIEGNTKSHIMLVQRQMSVIEEDLEEFQLALKHYVESASSQSGCLRISIQKLSNESRYM
IYEFWENSSVWNSHLQTNYSKTFQRSNVDFLETPELTSTMLVPASWWILNN
Download sequence
Identical sequences G3QCR7 Q8N987
gi|24308279|ref|NP_071746.1| ENSP00000387380 ENSP00000387380 ENSP00000387380 NP_071746.1.87134 NP_071746.1.92137 9606.ENSP00000242753

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]