SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|24308338|ref|NP_115939.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|24308338|ref|NP_115939.1|
Domain Number 1 Region: 93-270
Classification Level Classification E-value
Superfamily PH domain-like 4.38e-26
Family Pleckstrin-homology domain (PH domain) 0.022
Further Details:      
 
Domain Number 2 Region: 357-445
Classification Level Classification E-value
Superfamily PH domain-like 4.82e-20
Family Pleckstrin-homology domain (PH domain) 0.0000036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|24308338|ref|NP_115939.1|
Sequence length 814
Comment actin filament-associated protein 1-like 2 isoform 2 [Homo sapiens]
Sequence
MERYKALEQLLTELDDFLKILDQENLSSTALVKKSCLAELLRLYTKSSSSDEEYIYMNKV
TINKQQNAESQGKAPEEQGLLPNGEPSQHSSAPQKSLPDLPPPKMIPERKQLAIPKTESP
EGYYEEAEPYDTSLNEDGEAVSSSYESYDEEDGSKGKSAPYQWPSPEAGIELMRDARICA
FLWRKKWLGQWAKQLCVIKDNRLLCYKSSKDHSPQLDVNLLGSSVIHKEKQVRKKEHKLK
ITPMNADVIVLGLQSKDQAEQWLRVIQEVSGLPSEGASEGNQYTPDAQRFNCQKPDIAEK
YLSASEYGSSVDGHPEVPETKDVKKKCSAGLKLSNLMNLGRKKSTSLEPVERSLETSSYL
NVLVNSQWKSRWCSVRDNHLHFYQDRNRSKVAQQPLSLVGCEVVPDPSPDHLYSFRILHK
GEELAKLEAKSSEEMGHWLGLLLSESGSKTDPEEFTYDYVDADRVSCIVSAAKNSLLLMQ
RKFSEPNTYIDGLPSQDRQEELYDDVDLSELTAAVEPTEEATPVADDPNERESDRVYLDL
TPVKSFLHGPSSAQAQASSPTLSCLDNATEALPADSGPGPTPDEPCIKCPENLGEQQLES
LEPEDPSLRITTVKIQTEQQRISFPPSCPDAVVATPPGASPPVKDRLRVTSAEIKLGKNR
TEAEVKRYTEEKERLEKKKEEIRGHLAQLRKEKRELKETLLKCTDKEVLASLEQKLKEID
EECRGEESRRVDLELSIMEVKDNLKKAEAGPVTLGTTVDTTHLENPKAVTPASAPDCTPV
NSATTLKNRPLSVVVTGKGTVLQKAKEWEKKGAS
Download sequence
Identical sequences ENSP00000358276 gi|24308338|ref|NP_115939.1| NP_115939.1.87134 NP_115939.1.92137 ENSP00000358276 hsi002010814.2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]