SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|24430132|ref|NP_036610.2| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|24430132|ref|NP_036610.2|
Domain Number 1 Region: 2-126
Classification Level Classification E-value
Superfamily PH domain-like 4.1e-29
Family GRAM domain 0.063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|24430132|ref|NP_036610.2|
Sequence length 261
Comment WW domain-binding protein 2 [Homo sapiens]
Sequence
MALNKNHSEGGGVIVNNTESILMSYDHVELTFNDMKNVPEAFKGTKKGTVYLTPYRVIFL
SKGKDAMQSFMMPFYLMKDCEIKQPVFGANYIKGTVKAEAGGGWEGSASYKLTFTAGGAI
EFGQRMLQVASQASRGEVPSGAYGYSYMPSGAYVYPPPVANGMYPCPPGYPYPPPPPEFY
PGPPMMDGAMGYVQPPPPPYPGPMEPPVSGPDVPSTPAAEAKAAEAAASAYYNPGNPHNV
YMPTSQPPPPPYYPPEDKKTQ
Download sequence
Identical sequences A0A024R8L1 G2HIQ3 G3R1G1 H2NUR2 Q969T9
9600.ENSPPYP00000009701 9606.ENSP00000254806 ENSPPYP00000009701 ENSP00000254806 ENSP00000467579 ENSPPYP00000009701 ENSGGOP00000009030 ENSP00000254806 ENSP00000467579 NP_001267430.1.37143 NP_036610.2.87134 NP_036610.2.92137 XP_003813321.1.60992 XP_004041064.1.27298 XP_009250323.1.23681 gi|24430132|ref|NP_036610.2| ENSGGOP00000009030 ENSP00000254806 4586

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]