SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|24430144|ref|NP_000838.3| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|24430144|ref|NP_000838.3|
Domain Number 1 Region: 81-211
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 1.33e-42
Family Glutathione S-transferase (GST), C-terminal domain 0.000043
Further Details:      
 
Domain Number 2 Region: 5-80
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.48e-32
Family SCOPe 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|24430144|ref|NP_000838.3|
Sequence length 222
Comment glutathione S-transferase A3 [Homo sapiens]
Sequence
MAGKPKLHYFNGRGRMEPIRWLLAAAGVEFEEKFIGSAEDLGKLRNDGSLMFQQVPMVEI
DGMKLVQTRAILNYIASKYNLYGKDIKERALIDMYTEGMADLNEMILLLPLCRPEEKDAK
IALIKEKTKSRYFPAFEKVLQSHGQDYLVGNKLSRADISLVELLYYVEELDSSLISNFPL
LKALKTRISNLPTVKKFLQPGSPRKPPADAKALEEARKIFRF
Download sequence
Identical sequences Q16772
gi|24430144|ref|NP_000838.3| 9606.ENSP00000211122 NP_000838.3.87134 NP_000838.3.92137 ENSP00000211122 1tdi_A 1tdi_B 2vcv_A 2vcv_B 2vcv_C 2vcv_D 2vcv_E 2vcv_F 2vcv_G 2vcv_H 2vcv_I 2vcv_J 2vcv_K 2vcv_L 2vcv_M 2vcv_N 2vcv_O 2vcv_P ENSP00000211122 ENSP00000360007

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]