SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|24497447|ref|NP_705931.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|24497447|ref|NP_705931.1|
Domain Number 1 Region: 309-438
Classification Level Classification E-value
Superfamily PH domain-like 1.16e-26
Family Ran-binding domain 0.0042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|24497447|ref|NP_705931.1|
Sequence length 440
Comment nuclear pore complex protein Nup50 isoform a [Homo sapiens]
Sequence
MASEEVLKNRAIKKAKRRNVGFESDTGGAFKGFKGLVVPSGGGRFSGFGSGAGGKPLEGL
SNGNNITSAPPFASAKAAADPKVAFGSLAANGPTTLVDKVSNPKTNGDSQQPSSSGLASS
KACVGNAYHKQLAALNCSVRDWIVKHVNTNPLCDLTPIFKDYEKYLANIEQQHGNSGRNS
ESESNKVAAETQSPSLFGSTKLQQESTFLFHGNKTEDTPDKKMEVASEKKTDPSSLGATS
ASFNFGKKVDSSVLGSLSSVPLTGFSFSPGNSSLFGKDTTQSKPVSSPFPTKPLEGQAEG
DSGECKGGDEEENDEPPKVVVTEVKEEDAFYSKKCKLFYKKDNEFKEKGIGTLHLKPTAN
QKTQLLVRADTNLGNILLNVLIPPNMPCTRTGKNNVLIVCVPNPPIDEKNATMPVTMLIR
VKTSEDADELHKILLEKKDA
Download sequence
Identical sequences ENSP00000379403 ENSP00000385555 ENSP00000379403 ENSP00000385555 NP_705931.1.87134 NP_705931.1.92137 XP_005261369.1.92137 XP_005261371.1.92137 XP_006724167.1.92137 XP_016884026.1.92137 gi|24497447|ref|NP_705931.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]