SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|24497451|ref|NP_009103.2| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|24497451|ref|NP_009103.2|
Domain Number 1 Region: 337-466
Classification Level Classification E-value
Superfamily PH domain-like 1.28e-26
Family Ran-binding domain 0.0042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|24497451|ref|NP_009103.2|
Sequence length 468
Comment nuclear pore complex protein Nup50 isoform b [Homo sapiens]
Sequence
MAKRNAEKELTDRNWDQEDEAEEVGTFSMASEEVLKNRAIKKAKRRNVGFESDTGGAFKG
FKGLVVPSGGGRFSGFGSGAGGKPLEGLSNGNNITSAPPFASAKAAADPKVAFGSLAANG
PTTLVDKVSNPKTNGDSQQPSSSGLASSKACVGNAYHKQLAALNCSVRDWIVKHVNTNPL
CDLTPIFKDYEKYLANIEQQHGNSGRNSESESNKVAAETQSPSLFGSTKLQQESTFLFHG
NKTEDTPDKKMEVASEKKTDPSSLGATSASFNFGKKVDSSVLGSLSSVPLTGFSFSPGNS
SLFGKDTTQSKPVSSPFPTKPLEGQAEGDSGECKGGDEEENDEPPKVVVTEVKEEDAFYS
KKCKLFYKKDNEFKEKGIGTLHLKPTANQKTQLLVRADTNLGNILLNVLIPPNMPCTRTG
KNNVLIVCVPNPPIDEKNATMPVTMLIRVKTSEDADELHKILLEKKDA
Download sequence
Identical sequences A0A024R4X7 Q9UKX7
gi|24497451|ref|NP_009103.2| ENSP00000345895 NP_009103.2.87134 NP_009103.2.92137 XP_006724166.1.92137 XP_011528135.1.92137 ENSP00000345895 ENSP00000345895 HR4558 9606.ENSP00000345895

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]