SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|24497566|ref|NP_695014.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|24497566|ref|NP_695014.1|
Domain Number 1 Region: 31-320
Classification Level Classification E-value
Superfamily (Trans)glycosidases 2.11e-108
Family Bee venom hyaluronidase 0.0000484
Further Details:      
 
Weak hits

Sequence:  gi|24497566|ref|NP_695014.1|
Domain Number - Region: 383-402
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0838
Family EGF-type module 0.067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|24497566|ref|NP_695014.1|
Sequence length 405
Comment hyaluronidase-1 isoform 2 [Homo sapiens]
Sequence
MAAHLLPICALFLTLLDMAQGFRGPLLPNRPFTTVWNANTQWCLERHGVDVDVSVFDVVA
NPGQTFRGPDMTIFYSSQLGTYPYYTPTGEPVFGGLPQNASLIAHLARTFQDILAAIPAP
DFSGLAVIDWEAWRPRWAFNWDTKDIYRQRSRALVQAQHPDWPAPQVEAVAQDQFQGAAR
AWMAGTLQLGRALRPRGLWGFYGFPDCYNYDFLSPNYTGQCPSGIRAQNDQLGWLWGQSR
ALYPSIYMPAVLEGTGKSQMYVQHRVAEAFRVAVAAGDPNLPVLPYVQIFYDTTNHFLPL
ESCQAIKEYMDTTLGPFILNVTSGALLCSQALCSGHGRCVRRTSHPKALLLLNPASFSIQ
LTPGGGPLSLRGALSLEDQAQMAVEFKCRCYPGWQAPWCERKSMW
Download sequence
Identical sequences A0A0S2Z3Q0
NP_695014.1.87134 NP_695014.1.92137 ENSP00000378575 ENSP00000459906 ENSP00000378575 gi|24497566|ref|NP_695014.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]