SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|24497568|ref|NP_695015.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|24497568|ref|NP_695015.1|
Domain Number 1 Region: 1-168
Classification Level Classification E-value
Superfamily (Trans)glycosidases 1.16e-60
Family Bee venom hyaluronidase 0.00028
Further Details:      
 
Weak hits

Sequence:  gi|24497568|ref|NP_695015.1|
Domain Number - Region: 231-250
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0369
Family EGF-type module 0.067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|24497568|ref|NP_695015.1|
Sequence length 253
Comment hyaluronidase-1 isoform 3 [Homo sapiens]
Sequence
MAGTLQLGRALRPRGLWGFYGFPDCYNYDFLSPNYTGQCPSGIRAQNDQLGWLWGQSRAL
YPSIYMPAVLEGTGKSQMYVQHRVAEAFRVAVAAGDPNLPVLPYVQIFYDTTNHFLPLDE
LEHSLGESAAQGAAGVVLWVSWENTRTKESCQAIKEYMDTTLGPFILNVTSGALLCSQAL
CSGHGRCVRRTSHPKALLLLNPASFSIQLTPGGGPLSLRGALSLEDQAQMAVEFKCRCYP
GWQAPWCERKSMW
Download sequence
Identical sequences gi|24497568|ref|NP_695015.1| ENSP00000393358 ENSP00000393358 ENSP00000459311 NP_695015.1.87134 NP_695015.1.92137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]