SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|24762239|ref|NP_733772.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|24762239|ref|NP_733772.1|
Domain Number 1 Region: 6-412
Classification Level Classification E-value
Superfamily Ras GEF 4.71e-102
Family Ras GEF 0.00026
Further Details:      
 
Domain Number 2 Region: 484-544
Classification Level Classification E-value
Superfamily Cysteine-rich domain 5.83e-17
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.00099
Further Details:      
 
Domain Number 3 Region: 418-481
Classification Level Classification E-value
Superfamily EF-hand 0.00000000000248
Family Calmodulin-like 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|24762239|ref|NP_733772.1|
Sequence length 690
Comment ras guanyl-releasing protein 3 isoform 1 [Homo sapiens]
Sequence
MGSSGLGKAATLDELLCTCIEMFDDNGELDNSYLPRIVLLMHRWYLSSTELAEKLLCMYR
NATGESCNEFRLKICYFMRYWILKFPAEFNLDLGLIRMTEEFREVASQLGYEKHVSLIDI
SSIPSYDWMRRVTQRKKVSKKGKACLLFDHLEPIELAEHLTFLEHKSFRRISFTDYQSYV
IHGCLENNPTLERSIALFNGISKWVQLMVLSKPTPQQRAEVITKFINVAKKLLQLKNFNT
LMAVVGGLSHSSISRLKETHSHLSSEVTKNWNEMTELVSSNGNYCNYRKAFADCDGFKIP
ILGVHLKDLIAVHVIFPDWTEENKVNIVKMHQLSVTLSELVSLQNASHHLEPNMDLINLL
TLSLDLYHTEDDIYKLSLVLEPRNSKSQPTSPTTPNKPVVPLEWALGVMPKPDPTVINKH
IRKLVESVFRNYDHDHDGYISQEDFESIAANFPFLDSFCVLDKDQDGLISKDEMMAYFLR
AKSQLHCKMGPGFIHNFQEMTYLKPTFCEHCAGFLWGIIKQGYKCKDCGANCHKQCKDLL
VLACRRFARAPSLSSGHGSLPGSPSLPPAQDEVFEFPGVTAGHRDLDSRAITLVTGSSRK
ISVRLQRATTSQATQTEPVWSEAGWGDSGSHTFPKMKSKFHDKAAKDKGFAKWENEKPRV
HAGVDVVDRGTEFELDQDEGEETRQDGEDG
Download sequence
Identical sequences Q8IV61
ENSP00000384192 ENSP00000385886 ENSP00000383917 gi|213385270|ref|NP_001132960.1| gi|24762239|ref|NP_733772.1| 9606.ENSP00000384192 ENSP00000384192 ENSP00000385886 HR3495 NP_001132960.1.87134 NP_001132960.1.92137 NP_733772.1.87134 NP_733772.1.92137 XP_011531048.1.92137 XP_011531049.1.92137 XP_011531050.2.92137 XP_016859248.1.92137 XP_016859249.1.92137 XP_016859250.1.92137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]