SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|24797103|ref|NP_722541.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|24797103|ref|NP_722541.1|
Domain Number 1 Region: 9-399
Classification Level Classification E-value
Superfamily Ras GEF 2.88e-95
Family Ras GEF 0.00044
Further Details:      
 
Domain Number 2 Region: 495-549
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.0000000000000121
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.0017
Further Details:      
 
Domain Number 3 Region: 408-489
Classification Level Classification E-value
Superfamily EF-hand 0.0000000000000488
Family Polcalcin 0.071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|24797103|ref|NP_722541.1|
Sequence length 609
Comment RAS guanyl-releasing protein 2 [Homo sapiens]
Sequence
MAGTLDLDKGCTVEELLRGCIEAFDDSGKVRDPQLVRMFLMMHPWYIPSSQLAAKLLHIY
QQSRKDNSNSLQVKTCHLVRYWISAFPAEFDLNPELAEQIKELKALLDQEGNRRHSSLID
IDSVPTYKWKRQVTQRNPVGQKKRKMSLLFDHLEPMELAEHLTYLEYRSFCKILFQDYHS
FVTHGCTVDNPVLERFISLFNSVSQWVQLMILSKPTAPQRALVITHFVHVAEKLLQLQNF
NTLMAVVGGLSHSSISRLKETHSHVSPETIKLWEGLTELVTATGNYGNYRRRLAACVGFR
FPILGVHLKDLVALQLALPDWLDPARTRLNGAKMKQLFSILEELAMVTSLRPPVQANPDL
LSLLTVSLDQYQTEDELYQLSLQREPRSKSSPTSPTSCTPPPRPPVLEEWTSAAKPKLDQ
ALVVEHIEKMVESVFRNFDVDGDGHISQEEFQIIRGNFPYLSAFGDLDQNQDGCISREEM
VSYFLRSSSVLGGRMGFVHNFQESNSLRPVACRHCKALILGIYKQGLKCRACGVNCHKQC
KDRLSVECRRRAQSVSLEGSAPSPSPMHSHHHRAFSFSLPRPGRRGSRPPEIREEEVQTV
EDGVFDIHL
Download sequence
Identical sequences Q7LDG7
NP_001092140.1.87134 NP_001092140.1.92137 NP_001092141.1.87134 NP_001092141.1.92137 NP_722541.1.87134 NP_722541.1.92137 ENSP00000338864 ENSP00000366717 ENSP00000377953 9606.ENSP00000338864 gi|149158727|ref|NP_001092140.1| gi|149158729|ref|NP_001092141.1| gi|24797103|ref|NP_722541.1| NYSGRC-24797103 ENSP00000338864 ENSP00000366717 ENSP00000377953

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]