SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|254039592|ref|NP_116564.2| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|254039592|ref|NP_116564.2|
Domain Number 1 Region: 2-94
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 6.66e-34
Family Non-canonical RBD domain 0.0001
Further Details:      
 
Domain Number 2 Region: 98-252
Classification Level Classification E-value
Superfamily L domain-like 2.72e-32
Family mRNA export factor tap 0.00000362
Further Details:      
 
Domain Number 3 Region: 264-347
Classification Level Classification E-value
Superfamily NTF2-like 0.0000000000000643
Family NTF2-like 0.0004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|254039592|ref|NP_116564.2|
Sequence length 365
Comment nuclear RNA export factor 5 [Homo sapiens]
Sequence
MRRNTQDENMRKWFKVTIPYGIKYDKAWLMNSIQSNCSVPFTPVDFHYIRNRACFFVQVA
SAASALKDVSYKIYDDENQKICIFVSHFTAPYSVKNKLKPGQMEMLKLTMNKRYNVSQQA
LDLQNLRFDPDLMGRDIDIILNRRNCMAATLKITERNFPELLSLNLCNNKLYQLDGLSDI
TEKAPKVKTLNLSKNKLESAWELGKVKGLKLEELWLEGNPLCSTFSDQSAYVSAIRDCFP
KLLRLDGRELSAPVIVDIDSSETMKPCKENFTGSETLKHLVLQFLQQSNLCKYFKDSRNI
KILKDPYLQRKLLKHTKCPRNVDSLSALPETQHDFTSILVDMWYQTVNTCFLPRAGPESQ
SLRPL
Download sequence
Identical sequences NP_116564.2.87134 NP_116564.2.92137 ENSP00000426978 ENSP00000442401 ENSP00000426978 gi|254039592|ref|NP_116564.2|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]