SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|255652964|ref|NP_001157398.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|255652964|ref|NP_001157398.1|
Domain Number 1 Region: 50-249
Classification Level Classification E-value
Superfamily L domain-like 3.23e-40
Family Ngr ectodomain-like 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|255652964|ref|NP_001157398.1|
Sequence length 370
Comment leucine-rich repeat and transmembrane domain-containing protein 2 precursor [Homo sapiens]
Sequence
MLAPGSSPGQRGRLALQWRQVSWITCWIALYAVEALPTCPFSCKCDSRSLEVDCSGLGLT
TVPPDVPAATRTLLLLNNKLSALPSWAFANLSSLQRLDLSNNFLDRLPRSIFGDLTNLTE
LQLRNNSIRTLDRDLLRHSPLLRHLDLSINGLAQLPPGLFDGLLALRSLSLRSNRLQNLD
RLTFEPLANLQLLQVGDNPWECDCNLREFKHWMEWFSYRGGRLDQLACTLPKELRGKDMR
MVPMEMFNYCSQLEDENSSAGLDIPGPPCTKASPEPAKPKPGAEPEPEPSTACPQKQRHR
PASVRRAMGTVIIAGVVCGVVCIMMVVAAAYGCIYASLMAKYHRELKKRQPLMGDPEGEH
EDQKQISSVA
Download sequence
Identical sequences Q8N967
9606.ENSP00000299194 ENSP00000299194 gi|255652962|ref|NP_001157397.1| gi|255652964|ref|NP_001157398.1| gi|84781739|ref|NP_001034118.1| ENSP00000299194 ENSP00000444737 ENSP00000446278 NP_001034118.1.87134 NP_001034118.1.92137 NP_001157397.1.87134 NP_001157397.1.92137 NP_001157398.1.87134 NP_001157398.1.92137 XP_011519317.1.92137 ENSP00000299194 ENSP00000444737 ENSP00000446278

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]