SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|255958313|ref|NP_001353.4| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|255958313|ref|NP_001353.4|
Domain Number 1 Region: 129-198
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.00000561
Family Thioltransferase 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|255958313|ref|NP_001353.4|
Sequence length 304
Comment type III iodothyronine deiodinase [Homo sapiens]
Sequence
MPRQATSRLVVGEGEGSQGASGPAATMLRSLLLHSLRLCAQTASCLVLFPRFLGTAFMLW
LLDFLCIRKHFLGRRRRGQPEPEVELNSEGEEVPPDDPPICVSDDNRLCTLASLKAVWHG
QKLDFFKQAHEGGPAPNSEVVLPDGFQSQHILDYAQGNRPLVLNFGSCTUPPFMARMSAF
QRLVTKYQRDVDFLIIYIEEAHPSDGWVTTDSPYIIPQHRSLEDRVSAARVLQQGAPGCA
LVLDTMANSSSSAYGAYFERLYVIQSGTIMYQGGRGPDGYQVSELRTWLERYDEQLHGAR
PRRV
Download sequence
Identical sequences P55073
NP_001353.4.87134 NP_001353.4.92137 gi|255958313|ref|NP_001353.4| ENSP00000427336 ENSP00000427336 ENSP00000427336

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]