SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|256222411|ref|NP_001157789.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|256222411|ref|NP_001157789.1|
Domain Number 1 Region: 7-237
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 4.8e-78
Family Calponin-homology domain, CH-domain 0.0000937
Further Details:      
 
Domain Number 2 Region: 1305-1417
Classification Level Classification E-value
Superfamily E set domains 1.67e-35
Family Filamin repeat (rod domain) 0.00000262
Further Details:      
 
Domain Number 3 Region: 1216-1326
Classification Level Classification E-value
Superfamily E set domains 2.14e-31
Family Filamin repeat (rod domain) 0.000000892
Further Details:      
 
Domain Number 4 Region: 1525-1642
Classification Level Classification E-value
Superfamily E set domains 4.74e-31
Family Filamin repeat (rod domain) 0.0000281
Further Details:      
 
Domain Number 5 Region: 1623-1738
Classification Level Classification E-value
Superfamily E set domains 6.47e-31
Family Filamin repeat (rod domain) 0.0000039
Further Details:      
 
Domain Number 6 Region: 1038-1127
Classification Level Classification E-value
Superfamily E set domains 1.47e-30
Family Filamin repeat (rod domain) 0.00000333
Further Details:      
 
Domain Number 7 Region: 430-547
Classification Level Classification E-value
Superfamily E set domains 1.07e-29
Family Filamin repeat (rod domain) 0.00065
Further Details:      
 
Domain Number 8 Region: 1419-1460,1492-1558
Classification Level Classification E-value
Superfamily E set domains 4.2e-29
Family Filamin repeat (rod domain) 0.00000537
Further Details:      
 
Domain Number 9 Region: 1848-1943
Classification Level Classification E-value
Superfamily E set domains 2.07e-28
Family Filamin repeat (rod domain) 0.0000128
Further Details:      
 
Domain Number 10 Region: 823-943
Classification Level Classification E-value
Superfamily E set domains 4.84e-28
Family Filamin repeat (rod domain) 0.00044
Further Details:      
 
Domain Number 11 Region: 643-752
Classification Level Classification E-value
Superfamily E set domains 2.93e-27
Family Filamin repeat (rod domain) 0.00075
Further Details:      
 
Domain Number 12 Region: 2219-2315
Classification Level Classification E-value
Superfamily E set domains 5.4e-27
Family Filamin repeat (rod domain) 0.00000992
Further Details:      
 
Domain Number 13 Region: 1130-1239
Classification Level Classification E-value
Superfamily E set domains 1.67e-26
Family Filamin repeat (rod domain) 0.00000305
Further Details:      
 
Domain Number 14 Region: 2029-2124
Classification Level Classification E-value
Superfamily E set domains 1.67e-26
Family Filamin repeat (rod domain) 0.00000323
Further Details:      
 
Domain Number 15 Region: 252-349
Classification Level Classification E-value
Superfamily E set domains 3.74e-25
Family Filamin repeat (rod domain) 0.00086
Further Details:      
 
Domain Number 16 Region: 352-450
Classification Level Classification E-value
Superfamily E set domains 4.47e-25
Family Filamin repeat (rod domain) 0.001
Further Details:      
 
Domain Number 17 Region: 2542-2632
Classification Level Classification E-value
Superfamily E set domains 6.67e-25
Family Filamin repeat (rod domain) 0.0000165
Further Details:      
 
Domain Number 18 Region: 2413-2504
Classification Level Classification E-value
Superfamily E set domains 2e-24
Family Filamin repeat (rod domain) 0.0000148
Further Details:      
 
Domain Number 19 Region: 741-842
Classification Level Classification E-value
Superfamily E set domains 3.02e-24
Family Filamin repeat (rod domain) 0.00063
Further Details:      
 
Domain Number 20 Region: 2320-2411
Classification Level Classification E-value
Superfamily E set domains 5.74e-24
Family Filamin repeat (rod domain) 0.0000166
Further Details:      
 
Domain Number 21 Region: 537-639
Classification Level Classification E-value
Superfamily E set domains 6.61e-24
Family Filamin repeat (rod domain) 0.0002
Further Details:      
 
Domain Number 22 Region: 951-1052
Classification Level Classification E-value
Superfamily E set domains 9.14e-22
Family Filamin repeat (rod domain) 0.00086
Further Details:      
 
Domain Number 23 Region: 2141-2236
Classification Level Classification E-value
Superfamily E set domains 6.67e-21
Family Filamin repeat (rod domain) 0.00001
Further Details:      
 
Domain Number 24 Region: 1939-2027
Classification Level Classification E-value
Superfamily E set domains 6.01e-18
Family Filamin repeat (rod domain) 0.00000529
Further Details:      
 
Domain Number 25 Region: 1786-1862
Classification Level Classification E-value
Superfamily E set domains 3e-16
Family Filamin repeat (rod domain) 0.00012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|256222411|ref|NP_001157789.1|
Sequence length 2633
Comment filamin-B isoform 1 [Homo sapiens]
Sequence
MPVTEKDLAEDAPWKKIQQNTFTRWCNEHLKCVNKRIGNLQTDLSDGLRLIALLEVLSQK
RMYRKYHQRPTFRQMQLENVSVALEFLDRESIKLVSIDSKAIVDGNLKLILGLVWTLILH
YSISMPVWEDEGDDDAKKQTPKQRLLGWIQNKIPYLPITNFNQNWQDGKALGALVDSCAP
GLCPDWESWDPQKPVDNAREAMQQADDWLGVPQVITPEEIIHPDVDEHSVMTYLSQFPKA
KLKPGAPLKPKLNPKKARAYGRGIEPTGNMVKQPAKFTVDTISAGQGDVMVFVEDPEGNK
EEAQVTPDSDKNKTYSVEYLPKVTGLHKVTVLFAGQHISKSPFEVSVDKAQGDASKVTAK
GPGLEAVGNIANKPTYFDIYTAGAGVGDIGVEVEDPQGKNTVELLVEDKGNQVYRCVYKP
MQPGPHVVKIFFAGDTIPKSPFVVQVGEACNPNACRASGRGLQPKGVRIRETTDFKVDTK
AAGSGELGVTMKGPKGLEELVKQKDFLDGVYAFEYYPSTPGRYSIAITWGGHHIPKSPFE
VQVGPEAGMQKVRAWGPGLHGGIVGRSADFVVESIGSEVGSLGFAIEGPSQAKIEYNDQN
DGSCDVKYWPKEPGEYAVHIMCDDEDIKDSPYMAFIHPATGGYNPDLVRAYGPGLEKSGC
IVNNLAEFTVDPKDAGKAPLKIFAQDGEGQRIDIQMKNRMDGTYACSYTPVKAIKHTIAV
VWGGVNIPHSPYRVNIGQGSHPQKVKVFGPGVERSGLKANEPTHFTVDCTEAGEGDVSVG
IKCDARVLSEDEEDVDFDIIHNANDTFTVKYVPPAAGRYTIKVLFASQEIPASPFRVKVD
PSHDASKVKAEGPGLSKAGVENGKPTHFTVYTKGAGKAPLNVQFNSPLPGDAVKDLDIID
NYDYSHTVKYTPTQQGNMQVLVTYGGDPIPKSPFTVGVAAPLDLSKIKLNGLENRVEVGK
DQEFTVDTRGAGGQGKLDVTILSPSRKVVPCLVTPVTGRENSTAKFIPREEGLYAVDVTY
DGHPVPGSPYTVEASLPPDPSKVKAHGPGLEGGLVGKPAEFTIDTKGAGTGGLGLTVEGP
CEAKIECSDNGDGTCSVSYLPTKPGEYFVNILFEEVHIPGSPFKADIEMPFDPSKVVASG
PGLEHGKVGEAGLLSVDCSEAGPGALGLEAVSDSGTKAEVSIQNNKDGTYAVTYVPLTAG
MYTLTMKYGGELVPHFPARVKVEPAVDTSRIKVFGPGIEGKDVFREATTDFTVDSRPLTQ
VGGDHIKAHIANPSGASTECFVTDNADGTYQVEYTPFEKGLHVVEVTYDDVPIPNSPFKV
AVTEGCQPSRVQAQGPGLKEAFTNKPNVFTVVTRGAGIGGLGITVEGPSESKINCRDNKD
GSCSAEYIPFAPGDYDVNITYGGAHIPGSPFRVPVKDVVDPSKVKIAGPGLGSGVRARVL
QSFTVDSSKAGLAPLEVRVLGPRADDTDSQSWRSPLKALSEFFKGDPKGDFNKTGLVEPV
NVVDNGDGTHTVTYTPSQEGPYMVSVKYADEEIPRSPFKVKVLPTYDASKVTASGPGLSS
YGVPASLPVDFAIDARDAGEGLLAVQITDQEGKPKRAIVHDNKDGTYAVTYIPDKTGRYM
IGVTYGGDDIPLSPYRIRATQTGDASKCLATGPGIASTVKTGEEVGFVVDAKTAGKGKVT
CTVLTPDGTEAEADVIENEDGTYDIFYTAAKPGTYVIYVRFGGVDIPNSPFTVMATDGEV
TAVEEAPVNACPPGFRPWVTEEAYVPVSDMNGLGFKPFDLVIPFAVRKGEITGEVHMPSG
KTATPEIVDNKDGTVTVRYAPTEVGLHEMHIKYMGSHIPESPLQFYVNYPNSGSVSAYGP
GLVYGVANKTATFTIVTEDAGEGGLDLAIEGPSKAEISCIDNKDGTCTVTYLPTLPGDYS
ILVKYNDKHIPGSPFTAKITDDSRRCSQVKLGSAADFLLDISETDLSSLTASIKAPSGRD
EPCLLKRLPNNHIGISFIPREVGEHLVSIKKNGNHVANSPVSIMVVQSEIGDARRAKVYG
RGLSEGRTFEMSDFIVDTRDAGYGGISLAVEGPSKVDIQTEDLEDGTCKVSYFPTVPGVY
IVSTKFADEHVPGSPFTVKISGEGRVKESITRTSRAPSVATVGSICDLNLKIPEINSSDM
SAHVTSPSGRVTEAEIVPMGKNSHCVRFVPQEMGVHTVSVKYRGQHVTGSPFQFTVGPLG
EGGAHKVRAGGPGLERGEAGVPAEFSIWTREAGAGGLSIAVEGPSKAEITFDDHKNGSCG
VSYIAQEPGNYEVSIKFNDEHIPESPYLVPVIAPSDDARRLTVMSLQESGLKVNQPASFA
IRLNGAKGKIDAKVHSPSGAVEECHVSELEPDKYAVRFIPHENGVHTIDVKFNGSHVVGS
PFKVRVGEPGQAGNPALVSAYGTGLEGGTTGIQSEFFINTTRAGPGTLSVTIEGPSKVKM
DCQETPEGYKVMYTPMAPGNYLISVKYGGPNHIVGSPFKAKVTGQRLVSPGSANETSSIL
VESVTRSSTETCYSAIPKASSDASKVTSKGAGLSKAFVGQKSSFLVDCSKAGSNMLLIGV
HGPTTPCEEVSMKHVGNQQYNVTYVVKERGDYVLAVKWGEEHIPGSPFHVTVP
Download sequence
Identical sequences ENSP00000420213 gi|256222411|ref|NP_001157789.1| ENSP00000295956 ENSP00000420213 NP_001157789.1.87134 NP_001157789.1.92137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]