SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|256773203|ref|NP_001157950.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|256773203|ref|NP_001157950.1|
Domain Number 1 Region: 23-105
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.23e-19
Family Thioltransferase 0.0000308
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|256773203|ref|NP_001157950.1|
Sequence length 115
Comment glutaredoxin-like protein C5orf63 isoform 2 [Homo sapiens]
Sequence
MLWFQGNSMQLARSSFGLFLRNCSASKTTLPVLTLFTKDPCPLCDEAKEVLKPYENRFIL
QEVNITLPENSVWYERYKFDIPVFHLNGQFLMMHRVNTSKLEKQLLKLEQQSTGG
Download sequence
Identical sequences K7CP76
ENSP00000453964 gi|256773203|ref|NP_001157950.1| 9606.ENSP00000296662 NP_001157950.1.87134 NP_001157950.1.92137 XP_001158651.1.37143 XP_003826722.1.60992 ENSP00000453964

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]