SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|256985100|ref|NP_001157940.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|256985100|ref|NP_001157940.1|
Domain Number 1 Region: 45-132
Classification Level Classification E-value
Superfamily Supernatant protein factor (SPF), C-terminal domain 3.01e-22
Family Supernatant protein factor (SPF), C-terminal domain 0.015
Further Details:      
 
Domain Number 2 Region: 240-378
Classification Level Classification E-value
Superfamily Toll/Interleukin receptor TIR domain 0.0000000000000301
Family Toll/Interleukin receptor TIR domain 0.0044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|256985100|ref|NP_001157940.1|
Sequence length 404
Comment TRAM adaptor with GOLD domain isoform 1 [Homo sapiens]
Sequence
MPRPGSAQRWAAVAGRWGCRLLALLLLVPGPGGASEITFELPDNAKQCFYEDIAQGTKCT
LEFQVITGGHYDVDCRLEDPDGKVLYKEMKKQYDSFTFTASKNGTYKFCFSNEFSTFTHK
TVYFDFQVGEDPPLFPSENRVSALTQMESACVSIHEALKSVIDYQTHFRLREAQGRSRAE
DLNTRVAYWHSVDTSPGYHESDSKKSEDLSLCNVAEHSNTTEGPTGKQEGAQSVEEMFEE
EAEEEVFLKFVILHAEDDTDEALRVQNLLQDDFGIKPGIIFAEMPCGRQHLQNLDDAVNG
SAWTILLLTENFLRDTWCNFQFYTSLMNSVNRQHKYNSVIPMRPLNNPLPRERTPFALQT
INALEEESRGFPTQVERIFQESVYKTQQTIWKETRNMVQRQFIA
Download sequence
Identical sequences ENSP00000282382 ENSP00000386341 ENSP00000282382 ENSP00000386341 NP_001157940.1.87134 NP_001157940.1.92137 gi|256985100|ref|NP_001157940.1| ENSP00000282382

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]