SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|25777596|ref|NP_003639.2| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|25777596|ref|NP_003639.2|
Domain Number 1 Region: 276-404,716-889
Classification Level Classification E-value
Superfamily NAD kinase/diacylglycerol kinase-like 5.01e-52
Family Diacylglycerol kinase-like 0.022
Further Details:      
 
Domain Number 2 Region: 6-131
Classification Level Classification E-value
Superfamily PH domain-like 9.11e-29
Family Pleckstrin-homology domain (PH domain) 0.0059
Further Details:      
 
Domain Number 3 Region: 1097-1162
Classification Level Classification E-value
Superfamily SAM/Pointed domain 5.57e-19
Family SAM (sterile alpha motif) domain 0.0047
Further Details:      
 
Domain Number 4 Region: 177-246
Classification Level Classification E-value
Superfamily Cysteine-rich domain 2.24e-17
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.0000187
Further Details:      
 
Domain Number 5 Region: 113-172
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.00000000000449
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.0094
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|25777596|ref|NP_003639.2|
Sequence length 1170
Comment diacylglycerol kinase delta isoform 1 [Homo sapiens]
Sequence
MNMFLYFQTIIKEGMLTKQNNSFQRSKRRYFKLRGRTLYYAKTAKSIIFDEVDLTDASVA
ESSTKNVNNSFTVITPCRKLILCADNRKEMEDWIAALKTVQNREHFEPTQYSMDHFSGMH
NWYACSHARPTYCNVCREALSGVTSHGLSCEVCKFKAHKRCAVRATNNCKWTTLASIGKD
IIEDADGIAMPHQWLEGNLPVSAKCTVCDKTCGSVLRLQDWRCLWCKAMVHTSCKESLLT
KCPLGLCKVSVIPPTALNSIDSDGFWKASCPPSCTSPLLVFVNSKSGDNQGVKFLRRFKQ
LLNPAQVFDLMNGGPHLGLRLFQKFDTFRILVCGGDGSVGWVLSEIDSLNLHKQCQLGVL
PLGTGNDLARVLGWGSACDDDTQLPQILEKLERASTKMLDRWSVMAYEAKLPRQASSSTV
TEDFSEDSEVQQILFYEDSVAAHLSKILTSDQHSVVISSAKVLCETVKDFVARVGKAYEK
TTESSEESEVMAKKCSVLKEKLDSLLKTLDDESQASSSLPNPPPTIAEEAEDGDGSGSIC
GSTGDRLVASACPARPQIFRPREQLMLRANSLKKAIRQIIEHTEKAVDEQNAQTQEQEGF
VLGLSESEEKMDHRVCPPLSHSESFGVPKGRSQRKVSKSPCEKLISKGSLSLGSSASLPP
QPGSRDGLPALNTKILYPNVRAGMSGSLPGGSVISRLLINADPFNSEPETLEYYTEKCVM
NNYFGIGLDAKISLDFNNKRDEHPEKCRSRTKNMMWYGVLGTKELLHRTYKNLEQKVLLE
CDGRPIPLPSLQGIAVLNIPSYAGGTNFWGGTKEDDTFAAPSFDDKILEVVAVFGSMQMA
VSRVIRLQHHRIAQCRTVKISILGDEGVPVQVDGEAWVQPPGYIRIVHKNRAQTLTRDRA
FESTLKSWEDKQKCELPRPPSCSLHPEMLSEEEATQMDQFGQAAGVLIHSIREIAQSHRD
MEQELAHAVNASSKSMDRVYGKPRTTEGLNCSFVLEMVNNFRALRSETELLLSGKMALQL
DPPQKEQLGSALAEMDRQLRRLADTPWLCQSAEPGDEESVMLDLAKRSRSGKFRLVTKFK
KEKNNKNKEAHSSLGAPVHLWGTEEVAAWLEHLSLCEYKDIFTRHDIRGSELLHLERRDL
KDLGVTKVGHMKRILCGIKELSRSAPAVEA
Download sequence
Identical sequences A0A024R495
gi|25777596|ref|NP_003639.2| NP_003639.2.87134 NP_003639.2.92137 ENSP00000386455 ENSP00000386455

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]