SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|25777598|ref|NP_690618.2| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|25777598|ref|NP_690618.2|
Domain Number 1 Region: 320-448,760-933
Classification Level Classification E-value
Superfamily NAD kinase/diacylglycerol kinase-like 5.45e-52
Family Diacylglycerol kinase-like 0.022
Further Details:      
 
Domain Number 2 Region: 52-175
Classification Level Classification E-value
Superfamily PH domain-like 3.01e-28
Family Pleckstrin-homology domain (PH domain) 0.0059
Further Details:      
 
Domain Number 3 Region: 1141-1206
Classification Level Classification E-value
Superfamily SAM/Pointed domain 5.71e-19
Family SAM (sterile alpha motif) domain 0.0047
Further Details:      
 
Domain Number 4 Region: 221-290
Classification Level Classification E-value
Superfamily Cysteine-rich domain 2.39e-17
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.0000187
Further Details:      
 
Domain Number 5 Region: 157-216
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.00000000000478
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.0094
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|25777598|ref|NP_690618.2|
Sequence length 1214
Comment diacylglycerol kinase delta isoform 2 [Homo sapiens]
Sequence
MAAAAGAPPPGPPQPPPPPPPEESSDSEPEAEPGSPQKLIRKVSTSGQIRQKTIIKEGML
TKQNNSFQRSKRRYFKLRGRTLYYAKTAKSIIFDEVDLTDASVAESSTKNVNNSFTVITP
CRKLILCADNRKEMEDWIAALKTVQNREHFEPTQYSMDHFSGMHNWYACSHARPTYCNVC
REALSGVTSHGLSCEVCKFKAHKRCAVRATNNCKWTTLASIGKDIIEDADGIAMPHQWLE
GNLPVSAKCTVCDKTCGSVLRLQDWRCLWCKAMVHTSCKESLLTKCPLGLCKVSVIPPTA
LNSIDSDGFWKASCPPSCTSPLLVFVNSKSGDNQGVKFLRRFKQLLNPAQVFDLMNGGPH
LGLRLFQKFDTFRILVCGGDGSVGWVLSEIDSLNLHKQCQLGVLPLGTGNDLARVLGWGS
ACDDDTQLPQILEKLERASTKMLDRWSVMAYEAKLPRQASSSTVTEDFSEDSEVQQILFY
EDSVAAHLSKILTSDQHSVVISSAKVLCETVKDFVARVGKAYEKTTESSEESEVMAKKCS
VLKEKLDSLLKTLDDESQASSSLPNPPPTIAEEAEDGDGSGSICGSTGDRLVASACPARP
QIFRPREQLMLRANSLKKAIRQIIEHTEKAVDEQNAQTQEQEGFVLGLSESEEKMDHRVC
PPLSHSESFGVPKGRSQRKVSKSPCEKLISKGSLSLGSSASLPPQPGSRDGLPALNTKIL
YPNVRAGMSGSLPGGSVISRLLINADPFNSEPETLEYYTEKCVMNNYFGIGLDAKISLDF
NNKRDEHPEKCRSRTKNMMWYGVLGTKELLHRTYKNLEQKVLLECDGRPIPLPSLQGIAV
LNIPSYAGGTNFWGGTKEDDTFAAPSFDDKILEVVAVFGSMQMAVSRVIRLQHHRIAQCR
TVKISILGDEGVPVQVDGEAWVQPPGYIRIVHKNRAQTLTRDRAFESTLKSWEDKQKCEL
PRPPSCSLHPEMLSEEEATQMDQFGQAAGVLIHSIREIAQSHRDMEQELAHAVNASSKSM
DRVYGKPRTTEGLNCSFVLEMVNNFRALRSETELLLSGKMALQLDPPQKEQLGSALAEMD
RQLRRLADTPWLCQSAEPGDEESVMLDLAKRSRSGKFRLVTKFKKEKNNKNKEAHSSLGA
PVHLWGTEEVAAWLEHLSLCEYKDIFTRHDIRGSELLHLERRDLKDLGVTKVGHMKRILC
GIKELSRSAPAVEA
Download sequence
Identical sequences Q16760
gi|25777598|ref|NP_690618.2| ENSP00000264057 NP_690618.2.87134 NP_690618.2.92137 9606.ENSP00000264057 ENSP00000264057 ENSP00000264057

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]