SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|258613965|ref|NP_001158229.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|258613965|ref|NP_001158229.1|
Domain Number 1 Region: 16-170
Classification Level Classification E-value
Superfamily PH domain-like 5.47e-41
Family Phosphotyrosine-binding domain (PTB) 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|258613965|ref|NP_001158229.1|
Sequence length 501
Comment carboxyl-terminal PDZ ligand of neuronal nitric oxide synthase protein isoform 3 [Homo sapiens]
Sequence
MPSKTKYNLVDDGHDLRIPLHNEDAFQHGICFEAKYVGSLDVPRPNSRVEIVAAMRRIRY
EFKAKNIKKKKVSIMVSVDGVKVILKKKKKKKEWTWDESKMLVMQDPIYRIFYVSHDSQD
LKIFSYIARDGASNIFRCNVFKSKKKSQAMRIVRTVGQAFEVCHKLSLQHTQQNADGQED
GESERNSNSSGDPGRQLTGAERASTATAEETDIDAVEVPLPGNDVLEFSRGVTDLDAVGK
EGGSHTGSKVSHPQEPMLTASPRMLLPSSSSKPPGLGTETPLSTHHQMQLLQQLLQQQQQ
QTQVAVAQVHLLKDQLAAEAAARLEAQARVHQLLLQNKDMLQHISLLVKQVQELELKLSG
QNAMGSQDSLLEITFRSGALPVLCDPTTPKPEDLHSPPLGAGLADFAHPAGSPLGRRDCL
VKLECFRFLPPEDTPPPAQGEALLGGLELIKFRESGIASEYESNTDESEERDSWSQEELP
RLLNVLQRQELGDGLDDEIAV
Download sequence
Identical sequences F6SDV3
gi|258613965|ref|NP_001158229.1| ENSP00000431586 ENSP00000431586 ENSPTRP00000040790 ENSPTRP00000040790 NP_001158229.1.87134 NP_001158229.1.92137 NP_001158236.1.72884 XP_011808364.1.43180 XP_016786602.1.37143

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]