SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|259013547|ref|NP_001158507.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|259013547|ref|NP_001158507.1|
Domain Number 1 Region: 889-990
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000000188
Family Growth factor receptor domain 0.019
Further Details:      
 
Domain Number 2 Region: 683-822
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000033
Family Growth factor receptor domain 0.019
Further Details:      
 
Domain Number 3 Region: 994-1122
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000033
Family Growth factor receptor domain 0.0097
Further Details:      
 
Domain Number 4 Region: 604-647
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000051
Family EGF-type module 0.0061
Further Details:      
 
Domain Number 5 Region: 796-916
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000957
Family Growth factor receptor domain 0.018
Further Details:      
 
Domain Number 6 Region: 446-552,603-646
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000643
Family Growth factor receptor domain 0.019
Further Details:      
 
Weak hits

Sequence:  gi|259013547|ref|NP_001158507.1|
Domain Number - Region: 130-174
Classification Level Classification E-value
Superfamily FnI-like domain 0.00356
Family VWC domain 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|259013547|ref|NP_001158507.1|
Sequence length 1231
Comment fibulin-2 isoform a precursor [Homo sapiens]
Sequence
MVLLWEPAGAWLALGLALALGPSVAAAAPRQDCTGVECPPLENCIEEALEPGACCATCVQ
QGCACEGYQYYDCLQGGFVRGRVPAGQSYFVDFGSTECSCPPGGGKISCQFMLCPELPPN
CIEAVVVADSCPQCGQVGCVHAGHKYAAGHTVHLPPCRACHCPDAGGELICYQLPGCHGN
FSDAEEGDPERHYEDPYSYDQEVAEVEAATALGGEVQAGAVQAGAGGPPAALGGGSQPLS
TIQAPPWPAVLPRPTAAAALGPPAPVQAKARRVTEDSEEEEEEEEEREEMAVTEQLAAGG
HRGLDGLPTTAPAGPSLPIQEERAEAGARAEAGARPEENLILDAQATSRSTGPEGVTHAP
SLGKAALVPTQAVPGSPRDPVKPSPHNILSTSLPDAAWIPPTREVPRKPQVLPHSHVEED
TDPNSVHSIPRSSPEGSTKDLIETCCAAGQQWAIDNDECLEIPESGTEDNVCRTAQRHCC
VSYLQEKSCMAGVLGAKEGETCGAEDNDSCGISLYKQCCDCCGLGLRVRAEGQSCESNPN
LGYPCNHVMLSCCEGEEPLIVPEVRRPPEPAAAPRRVSEAEMAGREALSLGTEAELPNSL
PGDDQDECLLLPGELCQHLCINTVGSYHCACFPGFSLQDDGRTCRPEGHPPQPEAPQEPA
LKSEFSQVASNTIPLPLPQPNTCKDNGPCKQVCSTVGGSAICSCFPGYAIMADGVSCEDQ
DECLMGAHDCSRRQFCVNTLGSFYCVNHTVLCADGYILNAHRKCVDINECVTDLHTCSRG
EHCVNTLGSFHCYKALTCEPGYALKDGECEDVDECAMGTHTCQPGFLCQNTKGSFYCQAR
QRCMDGFLQDPEGNCVDINECTSLSEPCRPGFSCINTVGSYTCQRNPLICARGYHASDDG
TKCVDVNECETGVHRCGEGQVCHNLPGSYRCDCKAGFQRDAFGRGCIDVNECWASPGRLC
QHTCENTLGSYRCSCASGFLLAADGKRCEDVNECEAQRCSQECANIYGSYQCYCRQGYQL
AEDGHTCTDIDECAQGAGILCTFRCLNVPGSYQCACPEQGYTMTANGRSCKDVDECALGT
HNCSEAETCHNIQGSFRCLRFECPPNYVQVSKTKCERTTCHDFLECQNSPARITHYQLNF
QTGLLVPAHIFRIGPAPAFTGDTIALNIIKGNEEGYFGTRRLNAYTGVVYLQRAVLEPRD
FALDVEMKLWRQGSVTTFLAKMHIFFTTFAL
Download sequence
Identical sequences ENSP00000384169 ENSP00000420042 gi|259013547|ref|NP_001158507.1| gi|51873053|ref|NP_001004019.1| ENSP00000384169 ENSP00000420042 NP_001004019.1.87134 NP_001004019.1.92137 NP_001158507.1.87134 NP_001158507.1.92137 ENSP00000295760 9606.ENSP00000384169

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]