SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|259155293|ref|NP_061841.2| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|259155293|ref|NP_061841.2|
Domain Number 1 Region: 65-154
Classification Level Classification E-value
Superfamily PDZ domain-like 1.71e-26
Family PDZ domain 0.0013
Further Details:      
 
Domain Number 2 Region: 147-277
Classification Level Classification E-value
Superfamily PH domain-like 2.2e-24
Family Pleckstrin-homology domain (PH domain) 0.015
Further Details:      
 
Domain Number 3 Region: 293-422
Classification Level Classification E-value
Superfamily PH domain-like 0.0000492
Family Pleckstrin-homology domain (PH domain) 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|259155293|ref|NP_061841.2|
Sequence length 539
Comment gamma-2-syntrophin [Homo sapiens]
Sequence
MGTEGPPPPAASRGRQGCLLVPARTKTTIALLYDEESENAYDIRLKLTKEVLTIQKQDVV
CVGGSHQGRNRRTVTLRRQPVGGLGLSIKGGSEHNVPVVISKIFEDQAADQTGMLFVGDA
VLQVNGIHVENATHEEVVHLLRNAGDEVTITVEYLREAPAFLKLPLGSPGPSSDHSSGAS
SPLFDSGLHLNGNSSTTAPSSPSSPIAKDPRYEKRWLDTLSVPLSMARISRYKAGTEKLR
WNAFEVLALDGVSSGILRFYTAQDGTDWLRAVSANIRELTLQNMKMANKCCSPSDQVVHM
GWVNEKLQGADSSQTFRPKFLALKGPSFYVFSTPPVSTFDWVRAERTYHLCEVLFKVHKF
WLTEDCWLQANLYLGLQDFDFEDQRPYCFSIVAGHGKSHVFNVELGSELAMWEKSFQRAT
FMEVQRTGSRTYMCSWQGEMLCFTVDFALGFTCFESKTKNVLWRFKFSQLKGSSDDGKTR
VKLLFQNLDTKQIETKELEFQDLRAVLHCIHSFIAAKVASVDPGFMDSQSLARKYMYSS
Download sequence
Identical sequences Q9NY99
ENSP00000311837 9606.ENSP00000311837 gi|259155293|ref|NP_061841.2| ENSP00000385020 NP_061841.2.87134 NP_061841.2.92137 ENSP00000311837

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]