SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|260166694|ref|NP_001159451.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|260166694|ref|NP_001159451.1|
Domain Number 1 Region: 1085-1254,1312-1374,1440-1539
Classification Level Classification E-value
Superfamily PLC-like phosphodiesterases 9.54e-116
Family Mammalian PLC 0.00000495
Further Details:      
 
Domain Number 2 Region: 102-151,190-418,446-545
Classification Level Classification E-value
Superfamily Ras GEF 2.62e-40
Family Ras GEF 0.0057
Further Details:      
 
Domain Number 3 Region: 1825-1936
Classification Level Classification E-value
Superfamily Ubiquitin-like 7.06e-37
Family Ras-binding domain, RBD 0.00000112
Further Details:      
 
Domain Number 4 Region: 1699-1805
Classification Level Classification E-value
Superfamily Ubiquitin-like 7.03e-33
Family Ras-binding domain, RBD 0.00000104
Further Details:      
 
Domain Number 5 Region: 1565-1676
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 1.35e-22
Family PLC-like (P variant) 0.0031
Further Details:      
 
Domain Number 6 Region: 901-932,1015-1073
Classification Level Classification E-value
Superfamily EF-hand 0.00000000000511
Family EF-hand modules in multidomain proteins 0.045
Further Details:      
 
Weak hits

Sequence:  gi|260166694|ref|NP_001159451.1|
Domain Number - Region: 548-589,623-699
Classification Level Classification E-value
Superfamily PH domain-like 0.00246
Family Pleckstrin-homology domain (PH domain) 0.0086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|260166694|ref|NP_001159451.1|
Sequence length 1994
Comment 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase epsilon-1 isoform 2 [Homo sapiens]
Sequence
MVSEGSAAGRDFAGMEEVRQLHVRFCKGIKIWHQAWFLCSLLGREPQEREAGCQLWLCTL
SAVLKVGWLFPLSEVPNFTLLKDGCGCWRLKEDQIYNAVRREETENTVGSLLHFLTKLPA
SETAHGRISVGPCLKQCVRDTVCEYRATLQRTSISQYITGSLLEATTSLGARSGLLSTFG
GSTGRMMLKERQPGPSVANSNALPSSSAGISKELIDLQPLIQFPEEVASILMEQEQTIYR
RVLPVDYLCFLTRDLGTPECQSSLPCLKASISASILTTQNGEHNALEDLVMRFNEVSSWV
TWLILTAGSMEEKREVFSYLVHVAKCCWNMGNYNAVMEFLAGLRSRKVLKMWQFMDQSDI
ETMRSLKDAMAQHESSCEYRKVVTRALHIPGCKVVPFCGVFLKELCEVLDGASGLMKLCP
RYNSQEETLEFVADYSGQDNFLQRVGQNGLKNSEKESTVNSIFQVIRSCNRSLETDEEDS
PSEGNSSRKSSLKDKSRWQFIIGDLLDSDNDIFEQSKEYDSHGSEDSQKAFDHGTELIPW
YVLSIQADVHQFLLQGATVIHYDQDTHLSARCFLQLQPDNSTLTWVKPTTASPASSKAKL
GVLNNTAEPGKFPLLGNAGLSSLTEGVLDLFAVKAVYMGHPGIDIHTVCVQNKLGSMFLS
ETGVTLLYGLQTTDNRLLHFVAPKHTAKMLFSGLLELTRAVRKMRKFPDQRQQWLRKQYV
SLYQEDGRYEGPTLAHAVELFGGRRWSARNPSPGTSAKNAEKPNMQRNNTLGISTTKKKK
KILMRGESGEVTDDEMATRKAKMHKECRSRSGSDPQDINEQEESEVNAIANPPNPLPSRR
AHSLTTAGSPNLAAGTSSPIRPVSSPVLSSSNKSPSSAWSSSSWHGRIKGGMKGFQSFMV
SDSNMSFVEFVELFKSFSVRSRKDLKDLFDVYAVPCNRSGSESAPLYTNLTIDENTSDLQ
PDLDLLTRNVSDLGLFIKSKQQLSDNQRQISDAIAAASIVTNGTGIESTSLGIFGVGILQ
LNDFLVNCQGEHCTYDEILSIIQKFEPSISMCHQGLMSFEGFARFLMDKENFASKNDESQ
ENIKELQLPLSYYYIESSHNTYLTGHQLKGESSVELYSQVLLQGCRSVELDCWDGDDGMP
IIYHGHTLTTKIPFKEVVEAIDRSAFINSDLPIIISIENHCSLPQQRKMAEIFKTVFGEK
LVTKFLFETDFSDDPMLPSPDQLRKKVLLKNKKLKAHQTPVDILKQKAHQLASMQVQAYN
GGNANPRPANNEEEEDEEDEYDYDYESLSDDNILEDRPENKSCNDKLQFEYNEEIPKRIK
KADNSACNKGKVYDMELGEEFYLDQNKKESRQIAPELSDLVIYCQAVKFPGLSTLNASGS
SRGKERKSRKSIFGNNPGRMSPGETASFNKTSGKSSCEGIRQTWEESSSPLNPTTSLSAI
IRTPKCYHISSLNENAAKRLCRRYSQKLTQHTACQLLRTYPAATRIDSSNPNPLMFWLHG
IQLVALNYQTDDLPLHLNAAMFEANGGCGYVLKPPVLWDKNCPMYQKFSPLERDLDSMDP
AVYSLTIVSGQNVCPSNSMGSPCIEVDVLGMPLDSCHFRTKPIHRNTLNPMWNEQFLFHV
HFEDLVFLRFAVVENNSSAVTAQRIIPLKALKRGYRHLQLRNLHNEVLEISSLFINSRRM
EENSSGNTMSASSMFNTEERKCLQTHRVTVHGVPGPEPFTVFTINGGTKAKQLLQQILTN
EQDIKPVTTDYFLMEEKYFISKEKNECRKQPFQRAIGPEEEIMQILSSWFPEEGYMGRIV
LKTQQENLEEKNIVQDDKEVILSSEEESFFVQVHDVSPEQPRTVIKAPRVSTAQDVIQQT
LCKAKYSYSILSNPNPSDYVLLEEVVKDTTNKKTTTPKSSQRVLLDQECVFQAQSKWKGA
GKFILKLKEQVQASREDKKKGISFASELKKLTKSTKQPRGLTSPSQLLTSESIQTKEEKP
VGGLSSSDTMDYRQ
Download sequence
Identical sequences gi|260166694|ref|NP_001159451.1| NP_001159451.1.87134 NP_001159451.1.92137 ENSP00000360426 ENSP00000360438 ENSP00000360426 ENSP00000360438

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]